Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3265
Gene name
LocationContig_1839:4339..4641
Strand-
Gene length (bp)302
Transcript length (bp)237
Coding sequence length (bp)237
Protein length (aa) 79

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 2.9E-08 2 69

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74983|MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm2 PE=1 SV=1 1 77 1.0E-25
sp|Q9CAB6|UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana GN=UEV1B PE=1 SV=1 1 75 1.0E-23
sp|Q54D06|UBE2V_DICDI Probable ubiquitin-conjugating enzyme E2 variant OS=Dictyostelium discoideum GN=ube2v PE=3 SV=1 1 77 1.0E-23
sp|P53152|MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMS2 PE=1 SV=1 1 77 2.0E-22
sp|Q93YP0|UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana GN=UEV1A PE=1 SV=1 1 75 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74983|MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm2 PE=1 SV=1 1 77 1.0E-25
sp|Q9CAB6|UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana GN=UEV1B PE=1 SV=1 1 75 1.0E-23
sp|Q54D06|UBE2V_DICDI Probable ubiquitin-conjugating enzyme E2 variant OS=Dictyostelium discoideum GN=ube2v PE=3 SV=1 1 77 1.0E-23
sp|P53152|MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMS2 PE=1 SV=1 1 77 2.0E-22
sp|Q93YP0|UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana GN=UEV1A PE=1 SV=1 1 75 3.0E-22
sp|Q9SVD7|UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana GN=UEV1D PE=1 SV=1 1 77 2.0E-21
sp|Q5F3Z3|UB2V2_CHICK Ubiquitin-conjugating enzyme E2 variant 2 OS=Gallus gallus GN=UBE2V2 PE=2 SV=1 1 78 2.0E-21
sp|Q6PEH5|UB2V2_DANRE Ubiquitin-conjugating enzyme E2 variant 2 OS=Danio rerio GN=ube2v2 PE=2 SV=1 1 78 4.0E-21
sp|Q9SJ44|UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C OS=Arabidopsis thaliana GN=UEV1C PE=1 SV=1 1 77 5.0E-21
sp|Q3SZ52|UB2V1_BOVIN Ubiquitin-conjugating enzyme E2 variant 1 OS=Bos taurus GN=UBE2V1 PE=2 SV=1 1 78 6.0E-21
sp|Q13404|UB2V1_HUMAN Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens GN=UBE2V1 PE=1 SV=2 1 78 6.0E-21
sp|Q7M767|UB2V2_RAT Ubiquitin-conjugating enzyme E2 variant 2 OS=Rattus norvegicus GN=Ube2v2 PE=1 SV=3 1 78 7.0E-21
sp|Q90879|UB2V1_CHICK Ubiquitin-conjugating enzyme E2 variant 1 OS=Gallus gallus GN=UBE2V1 PE=2 SV=2 1 78 7.0E-21
sp|Q9CZY3|UB2V1_MOUSE Ubiquitin-conjugating enzyme E2 variant 1 OS=Mus musculus GN=Ube2v1 PE=1 SV=1 1 78 8.0E-21
sp|Q9D2M8|UB2V2_MOUSE Ubiquitin-conjugating enzyme E2 variant 2 OS=Mus musculus GN=Ube2v2 PE=1 SV=4 1 78 1.0E-20
sp|Q7ZYP0|UB2V2_XENLA Ubiquitin-conjugating enzyme E2 variant 2 OS=Xenopus laevis GN=ube2v2 PE=2 SV=1 1 78 3.0E-20
sp|Q5R6C9|UB2V2_PONAB Ubiquitin-conjugating enzyme E2 variant 2 OS=Pongo abelii GN=UBE2V2 PE=2 SV=1 1 78 3.0E-20
sp|Q15819|UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens GN=UBE2V2 PE=1 SV=4 1 78 3.0E-20
sp|Q3SZ43|UB2V2_BOVIN Ubiquitin-conjugating enzyme E2 variant 2 OS=Bos taurus GN=UBE2V2 PE=2 SV=3 1 78 3.0E-20
sp|Q5R4Z6|UB2V1_PONAB Ubiquitin-conjugating enzyme E2 variant 1 OS=Pongo abelii GN=UBE2V1 PE=2 SV=1 1 78 2.0E-19
sp|O45495|UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans GN=uev-1 PE=1 SV=1 1 77 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3265
MHCGDQYPDEPPTIQFVSQVNLPCVNPRNGVVDPSQLPCLAQWKRGNTMETVLIELRRYMAAPTNKKIPQPPEGS
TYS*
Coding >Hirsu2|3265
ATGCACTGCGGCGACCAGTACCCGGACGAGCCGCCGACGATCCAGTTCGTCAGCCAGGTCAACCTTCCGTGCGTG
AACCCGCGCAACGGCGTCGTCGACCCGAGCCAGCTGCCCTGCCTGGCCCAGTGGAAGCGCGGAAACACGATGGAG
ACGGTCCTGATCGAGCTGCGGAGATACATGGCGGCGCCCACCAACAAGAAGATCCCGCAGCCGCCCGAGGGCTCG
ACATACTCATGA
Transcript >Hirsu2|3265
ATGCACTGCGGCGACCAGTACCCGGACGAGCCGCCGACGATCCAGTTCGTCAGCCAGGTCAACCTTCCGTGCGTG
AACCCGCGCAACGGCGTCGTCGACCCGAGCCAGCTGCCCTGCCTGGCCCAGTGGAAGCGCGGAAACACGATGGAG
ACGGTCCTGATCGAGCTGCGGAGATACATGGCGGCGCCCACCAACAAGAAGATCCCGCAGCCGCCCGAGGGCTCG
ACATACTCATGA
Gene >Hirsu2|3265
ATGCACTGCGGCGACCAGTACCCGGACGAGCCGCCGACGATCCAGTTCGTCAGCCAGGTCAACCTTCCGTGCGTG
AACCCGCGCAACGGCGTCGTCGACCCGAGCCAGCTGCCCTGCCTGGCCCAGTGGAAGCGCGGAAACACGATGGAG
ACGGTCCTGATCGAGCTGCGGAGGTAAGGGGCCTCCAACTCCCCCTTCCCGTGAGCCCGGGCCGCTGACGGTGGT
CTCTCGCGTGCAGATACATGGCGGCGCCCACCAACAAGAAGATCCCGCAGCCGCCCGAGGGCTCGACATACTCAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail