Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3258
Gene name
LocationContig_1836:2439..4637
Strand+
Gene length (bp)2198
Transcript length (bp)2058
Coding sequence length (bp)2058
Protein length (aa) 686

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 85 107 22
3 117 139 22
4 146 168 22
5 584 606 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3258
MVKKAAAKADGESGLVVLWHRLDAVSRLVLLLGSPLLALALLALLLFWSESMRATAAGAAEPASSLWTRLVEANW
APRIVTVCTAVMRVVIALQASLVTAMVAAMVLERIGACLLYAPFLSIVRALPVAPTNLLFYYKAFPFGRRVLSFL
FYGLVVGETLVTVAAQFLSTIYLSDFRDSPYVGPTVAIKVGANRSSATRSWLPDTVSWTFAELSEPFRAGPNFHD
TGRAFRALLPFEDAARRTRLRRYRGPAVVFDARVVCVAPDLANLTVTNQGPEEMLARGRVAVDFAGVPGLRQPSG
KTGYDDFTCRLPDTLINIPGRFRDETIERQTSICRHDSNAGVVADDGWVGSAVLNDPARALGYRLAMVFEFPLPL
PPALRRFDVGRTSSLDLVRTDGPWQVARLGPEGLDLRISSCLVNYDARLGEVYMHSAWEGQEPGVSWEEKTDRWD
SEASRRQLGASTTPESLAHRGLLALEPQRPAPSLDALWTLNIYASFAGVVGREPFSVSGWALTTRGTSFLDSVRA
AVFHDTLASTGSPALAVQALVTRINQVAYYGRSYAADTAATAVFAATASVPARWTGFVAAAALVAIHLLLVAAAA
ALFLCLTRRSRVGDAWQAVAQVVSPDTLPLLERAGSVKGGGGQLRRRAGAMRRARLRRRPDGRVALDVRESDEGR
RRDAEARAER*
Coding >Hirsu2|3258
ATGGTCAAGAAGGCGGCCGCCAAGGCGGACGGCGAGAGCGGCCTCGTGGTCCTGTGGCACCGCCTCGACGCCGTC
AGCCGCCTCGTCCTCCTCCTCGGCTCGCCCCTCCTCGCCCTCGCCCTCCTCGCCCTCCTCCTCTTCTGGAGCGAG
TCGATGCGGGCGACGGCGGCCGGCGCGGCCGAGCCGGCGTCGTCGCTCTGGACGCGTCTCGTCGAGGCCAACTGG
GCCCCCCGGATCGTGACGGTGTGCACGGCCGTGATGCGCGTCGTCATCGCCTTGCAGGCGAGCCTGGTGACGGCC
ATGGTCGCGGCCATGGTCCTCGAGCGCATCGGCGCCTGCCTGCTCTACGCGCCCTTCCTGTCCATCGTCAGGGCC
CTCCCCGTCGCCCCGACCAACCTCCTCTTCTACTACAAGGCCTTCCCGTTCGGGCGCCGGGTCCTGTCCTTTCTC
TTCTACGGCCTCGTCGTCGGCGAGACGCTCGTCACCGTCGCCGCCCAGTTCCTCTCCACCATCTACCTGTCCGAC
TTCCGGGACAGCCCGTATGTCGGCCCGACGGTCGCGATCAAGGTCGGCGCCAACCGGTCCTCCGCCACAAGGTCC
TGGCTGCCCGACACGGTGAGCTGGACCTTTGCCGAGCTCTCGGAGCCGTTCCGCGCCGGCCCCAACTTCCACGAC
ACGGGCCGCGCCTTTCGCGCCCTGCTGCCGTTCGAGGACGCGGCGCGGCGGACAAGGCTTCGCCGGTACCGCGGC
CCGGCCGTCGTCTTCGACGCCCGCGTCGTCTGCGTCGCGCCCGACCTGGCCAACCTGACCGTCACCAACCAGGGG
CCGGAGGAGATGCTGGCACGTGGCCGCGTCGCCGTCGACTTCGCCGGCGTGCCCGGCCTGCGGCAGCCAAGCGGG
AAGACGGGATACGACGACTTCACCTGCCGACTCCCGGACACGCTCATCAACATACCCGGGCGATTTCGCGACGAG
ACGATCGAGCGGCAGACGAGCATATGCAGGCACGACTCCAACGCAGGGGTGGTGGCGGACGATGGCTGGGTCGGC
AGCGCTGTGCTCAACGACCCGGCCCGCGCGCTCGGCTACAGGCTAGCAATGGTCTTTGAATTCCCTCTCCCGCTC
CCCCCGGCCTTGCGGCGGTTCGACGTTGGCAGGACGAGCAGCCTCGACCTGGTCCGCACGGACGGCCCTTGGCAG
GTGGCGAGGCTGGGGCCCGAAGGCCTCGATCTGCGCATCTCGTCCTGCCTCGTCAACTACGACGCCCGGCTGGGC
GAGGTGTACATGCACAGCGCGTGGGAGGGCCAGGAGCCCGGCGTGTCGTGGGAGGAGAAGACGGACCGTTGGGAC
TCGGAGGCGAGCCGGCGCCAGCTGGGCGCGTCGACGACGCCCGAGAGTCTCGCTCACCGCGGCTTGCTCGCCCTG
GAGCCTCAGCGGCCGGCCCCGTCCCTCGACGCGCTCTGGACGCTAAACATATACGCCTCCTTCGCCGGCGTCGTC
GGCCGCGAGCCCTTCTCCGTCTCCGGCTGGGCCCTGACGACGCGCGGGACGTCGTTCCTGGACAGCGTCCGCGCG
GCCGTCTTCCACGACACGCTGGCCTCGACCGGCAGCCCGGCCCTGGCGGTGCAGGCGCTCGTGACGAGGATAAAC
CAGGTCGCCTACTACGGCCGGAGCTACGCGGCCGACACGGCCGCCACCGCCGTCTTCGCCGCCACTGCCTCGGTG
CCGGCGCGCTGGACCGGCTTCGTCGCCGCCGCCGCCCTCGTCGCCATCCACCTGCTCCTCGTCGCCGCCGCCGCC
GCGCTCTTCCTCTGTCTCACCCGCCGCTCCCGCGTCGGCGACGCGTGGCAGGCCGTCGCGCAGGTCGTCTCGCCC
GACACGCTGCCGCTGCTCGAGCGCGCCGGCTCCGTCAAGGGGGGCGGGGGTCAGCTCCGGCGTCGGGCCGGCGCC
ATGCGTCGCGCCCGCCTCCGGCGCCGGCCCGACGGACGCGTCGCCCTCGACGTGCGGGAGTCGGACGAAGGACGA
AGACGCGACGCCGAGGCACGCGCGGAACGATAG
Transcript >Hirsu2|3258
ATGGTCAAGAAGGCGGCCGCCAAGGCGGACGGCGAGAGCGGCCTCGTGGTCCTGTGGCACCGCCTCGACGCCGTC
AGCCGCCTCGTCCTCCTCCTCGGCTCGCCCCTCCTCGCCCTCGCCCTCCTCGCCCTCCTCCTCTTCTGGAGCGAG
TCGATGCGGGCGACGGCGGCCGGCGCGGCCGAGCCGGCGTCGTCGCTCTGGACGCGTCTCGTCGAGGCCAACTGG
GCCCCCCGGATCGTGACGGTGTGCACGGCCGTGATGCGCGTCGTCATCGCCTTGCAGGCGAGCCTGGTGACGGCC
ATGGTCGCGGCCATGGTCCTCGAGCGCATCGGCGCCTGCCTGCTCTACGCGCCCTTCCTGTCCATCGTCAGGGCC
CTCCCCGTCGCCCCGACCAACCTCCTCTTCTACTACAAGGCCTTCCCGTTCGGGCGCCGGGTCCTGTCCTTTCTC
TTCTACGGCCTCGTCGTCGGCGAGACGCTCGTCACCGTCGCCGCCCAGTTCCTCTCCACCATCTACCTGTCCGAC
TTCCGGGACAGCCCGTATGTCGGCCCGACGGTCGCGATCAAGGTCGGCGCCAACCGGTCCTCCGCCACAAGGTCC
TGGCTGCCCGACACGGTGAGCTGGACCTTTGCCGAGCTCTCGGAGCCGTTCCGCGCCGGCCCCAACTTCCACGAC
ACGGGCCGCGCCTTTCGCGCCCTGCTGCCGTTCGAGGACGCGGCGCGGCGGACAAGGCTTCGCCGGTACCGCGGC
CCGGCCGTCGTCTTCGACGCCCGCGTCGTCTGCGTCGCGCCCGACCTGGCCAACCTGACCGTCACCAACCAGGGG
CCGGAGGAGATGCTGGCACGTGGCCGCGTCGCCGTCGACTTCGCCGGCGTGCCCGGCCTGCGGCAGCCAAGCGGG
AAGACGGGATACGACGACTTCACCTGCCGACTCCCGGACACGCTCATCAACATACCCGGGCGATTTCGCGACGAG
ACGATCGAGCGGCAGACGAGCATATGCAGGCACGACTCCAACGCAGGGGTGGTGGCGGACGATGGCTGGGTCGGC
AGCGCTGTGCTCAACGACCCGGCCCGCGCGCTCGGCTACAGGCTAGCAATGGTCTTTGAATTCCCTCTCCCGCTC
CCCCCGGCCTTGCGGCGGTTCGACGTTGGCAGGACGAGCAGCCTCGACCTGGTCCGCACGGACGGCCCTTGGCAG
GTGGCGAGGCTGGGGCCCGAAGGCCTCGATCTGCGCATCTCGTCCTGCCTCGTCAACTACGACGCCCGGCTGGGC
GAGGTGTACATGCACAGCGCGTGGGAGGGCCAGGAGCCCGGCGTGTCGTGGGAGGAGAAGACGGACCGTTGGGAC
TCGGAGGCGAGCCGGCGCCAGCTGGGCGCGTCGACGACGCCCGAGAGTCTCGCTCACCGCGGCTTGCTCGCCCTG
GAGCCTCAGCGGCCGGCCCCGTCCCTCGACGCGCTCTGGACGCTAAACATATACGCCTCCTTCGCCGGCGTCGTC
GGCCGCGAGCCCTTCTCCGTCTCCGGCTGGGCCCTGACGACGCGCGGGACGTCGTTCCTGGACAGCGTCCGCGCG
GCCGTCTTCCACGACACGCTGGCCTCGACCGGCAGCCCGGCCCTGGCGGTGCAGGCGCTCGTGACGAGGATAAAC
CAGGTCGCCTACTACGGCCGGAGCTACGCGGCCGACACGGCCGCCACCGCCGTCTTCGCCGCCACTGCCTCGGTG
CCGGCGCGCTGGACCGGCTTCGTCGCCGCCGCCGCCCTCGTCGCCATCCACCTGCTCCTCGTCGCCGCCGCCGCC
GCGCTCTTCCTCTGTCTCACCCGCCGCTCCCGCGTCGGCGACGCGTGGCAGGCCGTCGCGCAGGTCGTCTCGCCC
GACACGCTGCCGCTGCTCGAGCGCGCCGGCTCCGTCAAGGGGGGCGGGGGTCAGCTCCGGCGTCGGGCCGGCGCC
ATGCGTCGCGCCCGCCTCCGGCGCCGGCCCGACGGACGCGTCGCCCTCGACGTGCGGGAGTCGGACGAAGGACGA
AGACGCGACGCCGAGGCACGCGCGGAACGATAG
Gene >Hirsu2|3258
ATGGTCAAGAAGGCGGCCGTGGCCACGCATAACCGACCTTGCTCCCTCCGCTCCTTACTGCGATTCATCGGAACA
GCGAACAAACACGATGCCGCAAAACAGTGCCCGGGCCTCGAAGGCTCGGCGCCATCCCTCCCCTTCGAGCTCCGA
GGCCGAAGGCCAAGGCGGACGGCGAGAGCGGCCTCGTGGTCCTGTGGCACCGCCTCGACGCCGTCAGCCGCCTCG
TCCTCCTCCTCGGCTCGCCCCTCCTCGCCCTCGCCCTCCTCGCCCTCCTCCTCTTCTGGAGCGAGTCGATGCGGG
CGACGGCGGCCGGCGCGGCCGAGCCGGCGTCGTCGCTCTGGACGCGTCTCGTCGAGGCCAACTGGGCCCCCCGGA
TCGTGACGGTGTGCACGGCCGTGATGCGCGTCGTCATCGCCTTGCAGGCGAGCCTGGTGACGGCCATGGTCGCGG
CCATGGTCCTCGAGCGCATCGGCGCCTGCCTGCTCTACGCGCCCTTCCTGTCCATCGTCAGGGCCCTCCCCGTCG
CCCCGACCAACCTCCTCTTCTACTACAAGGCCTTCCCGTTCGGGCGCCGGGTCCTGTCCTTTCTCTTCTACGGCC
TCGTCGTCGGCGAGACGCTCGTCACCGTCGCCGCCCAGTTCCTCTCCACCATCTACCTGTCCGACTTCCGGGACA
GCCCGTATGTCGGCCCGACGGTCGCGATCAAGGTCGGCGCCAACCGGTCCTCCGCCACAAGGTCCTGGCTGCCCG
ACACGGTGAGCTGGACCTTTGCCGAGCTCTCGGAGCCGTTCCGCGCCGGCCCCAACTTCCACGACACGGGCCGCG
CCTTTCGCGCCCTGCTGCCGTTCGAGGACGCGGCGCGGCGGACAAGGCTTCGCCGGTACCGCGGCCCGGCCGTCG
TCTTCGACGCCCGCGTCGTCTGCGTCGCGCCCGACCTGGCCAACCTGACCGTCACCAACCAGGGGCCGGAGGAGA
TGCTGGCACGTGGCCGCGTCGCCGTCGACTTCGCCGGCGTGCCCGGCCTGCGGCAGCCAAGCGGGAAGACGGGAT
ACGACGACTTCACCTGCCGACTCCCGGACACGCTCATCAACATACCCGGGCGATTTCGCGACGAGACGATCGAGC
GGCAGACGAGCATATGCAGGCACGACTCCAACGCAGGGGTGGTGGCGGACGATGGCTGGGTCGGCAGCGCTGTGC
TCAACGACCCGGCCCGCGCGCTCGGCTACAGGCTAGCAATGGTCTTTGAATTCCCTCTCCCGCTCCCCCCGGCCT
TGCGGCGGTTCGACGTTGGCAGGACGAGCAGCCTCGACCTGGTCCGCACGGACGGCCCTTGGCAGGTGGCGAGGC
TGGGGCCCGAAGGCCTCGATCTGCGCATCTCGTCCTGCCTCGTCAACTACGACGCCCGGCTGGGCGAGGTGTACA
TGCACAGCGCGTGGGAGGGCCAGGAGCCCGGCGTGTCGTGGGAGGAGAAGACGGACCGTTGGGACTCGGAGGCGA
GCCGGCGCCAGCTGGGCGCGTCGACGACGCCCGAGAGTCTCGCTCACCGCGGCTTGCTCGCCCTGGAGCCTCAGC
GGCCGGCCCCGTCCCTCGACGCGCTCTGGACGCTAAACATATACGCCTCCTTCGCCGGCGTCGTCGGCCGCGAGC
CCTTCTCCGTCTCCGGCTGGGCCCTGACGACGCGCGGGACGTCGTTCCTGGACAGCGTCCGCGCGGCCGTCTTCC
ACGACACGCTGGCCTCGACCGGCAGCCCGGCCCTGGCGGTGCAGGCGCTCGTGACGAGGATAAACCAGGTCGCCT
ACTACGGCCGGAGCTACGCGGCCGACACGGCCGCCACCGCCGTCTTCGCCGCCACTGCCTCGGTGCCGGCGCGCT
GGACCGGCTTCGTCGCCGCCGCCGCCCTCGTCGCCATCCACCTGCTCCTCGTCGCCGCCGCCGCCGCGCTCTTCC
TCTGTCTCACCCGCCGCTCCCGCGTCGGCGACGCGTGGCAGGCCGTCGCGCAGGTCGTCTCGCCCGACACGCTGC
CGCTGCTCGAGCGCGCCGGCTCCGTCAAGGGGGGCGGGGGTCAGCTCCGGCGTCGGGCCGGCGCCATGCGTCGCG
CCCGCCTCCGGCGCCGGCCCGACGGACGCGTCGCCCTCGACGTGCGGGAGTCGGACGAAGGACGAAGACGCGACG
CCGAGGCACGCGCGGAACGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail