Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3252
Gene name
LocationContig_1834:119..610
Strand-
Gene length (bp)491
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 1 106 2.0E-25
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 17 106 2.0E-09
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 1 106 5.0E-07
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 21 106 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3252
MRRLNLVLLAVLGLCDARVPSFSIHDDLLAFPQFDVVFSGGFISDQDADALLESRASHPTYSADFSQPTVAEAGG
HVGTEAEPRDAADAPTSYSYEVMNMPPHRYLRRRRAS*
Coding >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCAGGATGCAGACGCC
TTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGCCGAAGCGGGCGGC
CATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGAGGTGATGAACATG
CCGCCCCATCGCTACCTGCGGAGGAGGCGCGCGAGCTGA
Transcript >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCAGGATGCAGACGCC
TTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGCCGAAGCGGGCGGC
CATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGAGGTGATGAACATG
CCGCCCCATCGCTACCTGCGGAGGAGGCGCGCGAGCTGA
Gene >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGGTGAGCCGCAGCAGCCGCGGCCCGCACCCCCGGGGGGGGGAGGCCGCCTCT
CGCTTTGTCTGCCCTTGTTGCTAACGCGGCGGCACAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCA
GGATGCAGACGCCTTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGC
CGAAGCGGGCGGCCATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGA
GGTGATGAACATGCCGCCCCATCGCTACCTGTGCTCCATCCCCGCCATCCGGCCGCCGCCGGCCGAGAACCAGAC
GGCCAACGAGCTGGCCAAGGCGGAGGAGGCGCGCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail