Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3252
Gene name
LocationContig_1834:119..610
Strand-
Gene length (bp)491
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 1 106 2.0E-25
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 17 106 2.0E-09
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 1 106 5.0E-07
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 21 106 1.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1298 0.1033 0.8562 0.0704 0.0936 0.0084 0.2078 0.1557 0.1088 0.0074

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999743

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2357
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5252
Ophiocordyceps australis map64 (Brazil) OphauB2|394
Ophiocordyceps camponoti-floridani Ophcf2|05151
Ophiocordyceps camponoti-rufipedis Ophun1|5886
Ophiocordyceps kimflemingae Ophio5|6576
Ophiocordyceps subramaniannii Hirsu2|3252 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3252
MRRLNLVLLAVLGLCDARVPSFSIHDDLLAFPQFDVVFSGGFISDQDADALLESRASHPTYSADFSQPTVAEAGG
HVGTEAEPRDAADAPTSYSYEVMNMPPHRYLRRRRAS*
Coding >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCAGGATGCAGACGCC
TTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGCCGAAGCGGGCGGC
CATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGAGGTGATGAACATG
CCGCCCCATCGCTACCTGCGGAGGAGGCGCGCGAGCTGA
Transcript >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCAGGATGCAGACGCC
TTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGCCGAAGCGGGCGGC
CATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGAGGTGATGAACATG
CCGCCCCATCGCTACCTGCGGAGGAGGCGCGCGAGCTGA
Gene >Hirsu2|3252
ATGCGCCGTCTCAACTTGGTCTTGCTGGCCGTCCTTGGGCTGTGCGATGCCCGGGTTCCCAGCTTCAGCATCCAT
GACGACCTCCTTGCTTTCCCCCAGGTGAGCCGCAGCAGCCGCGGCCCGCACCCCCGGGGGGGGGAGGCCGCCTCT
CGCTTTGTCTGCCCTTGTTGCTAACGCGGCGGCACAGTTCGACGTCGTCTTCTCCGGAGGCTTCATCTCGGACCA
GGATGCAGACGCCTTACTCGAGTCTCGCGCCTCGCACCCGACCTATTCGGCCGACTTCTCGCAACCGACGGTAGC
CGAAGCGGGCGGCCATGTCGGCACCGAGGCCGAGCCGCGTGACGCTGCCGACGCCCCGACCAGCTACTCGTACGA
GGTGATGAACATGCCGCCCCATCGCTACCTGTGCTCCATCCCCGCCATCCGGCCGCCGCCGGCCGAGAACCAGAC
GGCCAACGAGCTGGCCAAGGCGGAGGAGGCGCGCGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail