Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3247
Gene name
LocationContig_1831:2776..3804
Strand+
Gene length (bp)1028
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.5E-18 43 269
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.9E-13 59 270
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.0E-13 33 278
PF01738 DLH Dienelactone hydrolase family 1.2E-04 220 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 16 285 4.0E-10
sp|P23106|XYLF_PSEPU 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas putida GN=xylF PE=1 SV=1 79 285 5.0E-10
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 28 248 6.0E-10
sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 53 285 1.0E-09
sp|Q8KZP5|MHPC_COMTE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Comamonas testosteroni GN=mhpC PE=1 SV=1 59 285 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 16 285 4.0E-10
sp|P23106|XYLF_PSEPU 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas putida GN=xylF PE=1 SV=1 79 285 5.0E-10
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 28 248 6.0E-10
sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 53 285 1.0E-09
sp|Q8KZP5|MHPC_COMTE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Comamonas testosteroni GN=mhpC PE=1 SV=1 59 285 2.0E-09
sp|P27747|ACOC_CUPNH Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoC PE=1 SV=3 10 126 3.0E-09
sp|Q7CWX3|RUTD_AGRFC Putative aminoacrylate hydrolase RutD OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rutD PE=3 SV=2 44 259 5.0E-09
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 27 285 2.0E-08
sp|Q52011|BPHD_PSEPS 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas pseudoalcaligenes GN=bphD PE=2 SV=1 59 285 3.0E-08
sp|P47229|BPHD_BURXL 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=bphD PE=1 SV=1 59 285 4.0E-08
sp|Q52036|BPHD_PSEPU 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas putida GN=bphD PE=3 SV=1 59 285 5.0E-08
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 27 267 7.0E-08
sp|B9JLT6|RUTD_AGRRK Putative aminoacrylate hydrolase RutD OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutD PE=3 SV=1 17 287 8.0E-08
sp|P17548|BPHD_PSES1 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas sp. (strain KKS102) GN=bphD PE=1 SV=2 59 285 8.0E-08
sp|A1VUV0|BPHD_POLNA 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bphD PE=3 SV=1 59 285 1.0E-07
sp|B1M5I5|RUTD_METRJ Putative aminoacrylate hydrolase RutD OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rutD PE=3 SV=1 25 288 2.0E-07
sp|Q8X5K0|MHPC_ECO57 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O157:H7 GN=mhpC PE=3 SV=3 50 285 3.0E-07
sp|B7N8Q6|MHPC_ECOLU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|A7ZI96|MHPC_ECO24 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|B7L505|MHPC_ECO55 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|B7NK06|MHPC_ECO7I 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|B7M2Z7|MHPC_ECO8A 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O8 (strain IAI1) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|A7ZWZ6|MHPC_ECOHS 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|B6HZX5|MHPC_ECOSE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain SE11) GN=mhpC PE=3 SV=2 50 285 3.0E-07
sp|B7MPB6|MHPC_ECO81 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O81 (strain ED1a) GN=mhpC PE=3 SV=2 50 285 4.0E-07
sp|Q8KRD3|BPHD_DELAC 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Delftia acidovorans GN=bphD PE=3 SV=2 59 285 4.0E-07
sp|B1ZB18|RUTD_METPB Putative aminoacrylate hydrolase RutD OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutD PE=3 SV=1 27 267 1.0E-06
sp|Q47HL4|MHPC1_DECAR 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Dechloromonas aromatica (strain RCB) GN=mhpC1 PE=3 SV=1 50 285 1.0E-06
sp|P77044|MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) GN=mhpC PE=1 SV=4 50 285 1.0E-06
sp|B1XBJ6|MHPC_ECODH 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=mhpC PE=3 SV=2 50 285 1.0E-06
sp|Q59324|BPHD_COMTE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Comamonas testosteroni GN=bphD PE=3 SV=1 59 285 2.0E-06
sp|Q13QH4|MHPC_BURXL 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=mhpC PE=3 SV=1 50 285 6.0E-06
sp|C5CN82|RUTD_VARPS Putative aminoacrylate hydrolase RutD OS=Variovorax paradoxus (strain S110) GN=rutD PE=3 SV=1 21 292 8.0E-06
sp|C5B0U6|RUTD_METEA Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=rutD PE=3 SV=1 27 267 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular|Mitochondrion Peroxisomal targeting signal 0.7206 0.2451 0.7179 0.1435 0.6571 0.1152 0.0384 0.1366 0.1288 0.3428

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6093
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6626
Ophiocordyceps australis map64 (Brazil) OphauB2|3091
Ophiocordyceps subramaniannii Hirsu2|3247 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3247
MATYETAPDQFVDVGGIRFAYRRFGRPAGIPLVLFMHFRGTMDHWDPALVNPLAARRPVVLIDNAGVGRSGGEVA
KTFAGWARHYVDVIRALGIDQADLLGFSMGGCVAQMAALNAPRLVRRLVLCGTIPSAGEGVTRAPLGPFNRLKAA
ATADEQRQAFLDAFFTRSARSQAAGRAAWARISAARPARSPSLGPEAAHRQAVAFAKFMDPRQAQDASFDRFAEL
GLPVLIANGSDDLLLPTENSIVMWRKLSHADAQLHLYPDAGHGFLYQYAGPFAALVNRFLDADVDSPEAAPSSRL
*
Coding >Hirsu2|3247
ATGGCCACCTACGAGACGGCACCGGACCAGTTCGTCGACGTCGGCGGCATCCGATTCGCCTACCGCCGCTTCGGC
CGGCCGGCCGGCATCCCGCTCGTGCTCTTCATGCACTTCAGGGGAACGATGGACCACTGGGATCCCGCGCTGGTC
AACCCGTTGGCCGCCCGGCGCCCCGTCGTGCTGATAGACAACGCGGGCGTCGGGCGGTCGGGCGGCGAGGTGGCC
AAGACGTTCGCCGGCTGGGCGCGGCACTACGTCGACGTCATCCGCGCTCTCGGCATCGACCAGGCCGACCTCCTG
GGCTTCTCCATGGGCGGCTGCGTCGCGCAGATGGCGGCCCTCAACGCCCCGCGCCTCGTCCGTCGCCTCGTCCTC
TGCGGCACCATCCCCAGCGCGGGCGAGGGCGTGACGCGGGCGCCGCTGGGCCCCTTCAACCGGCTCAAGGCCGCC
GCCACGGCCGACGAGCAGCGCCAGGCCTTCCTCGATGCCTTCTTCACCCGCTCCGCCCGCAGCCAGGCGGCCGGC
AGGGCGGCCTGGGCGCGCATCAGCGCCGCCCGCCCGGCCAGGTCCCCGTCCCTCGGGCCCGAGGCCGCCCACAGG
CAGGCCGTCGCCTTCGCCAAGTTCATGGACCCGCGCCAGGCCCAGGACGCCTCCTTCGACCGCTTCGCCGAGCTC
GGCCTGCCGGTGCTGATTGCCAATGGGAGCGACGACCTGCTGCTGCCGACCGAAAACAGCATCGTCATGTGGAGG
AAGCTGAGCCATGCCGACGCCCAGCTGCACCTGTACCCGGACGCCGGCCATGGGTTCCTGTACCAGTACGCCGGG
CCCTTTGCAGCCCTCGTCAACCGCTTCCTCGACGCCGACGTCGACAGCCCCGAGGCAGCCCCCTCCAGCCGGCTG
TAG
Transcript >Hirsu2|3247
ATGGCCACCTACGAGACGGCACCGGACCAGTTCGTCGACGTCGGCGGCATCCGATTCGCCTACCGCCGCTTCGGC
CGGCCGGCCGGCATCCCGCTCGTGCTCTTCATGCACTTCAGGGGAACGATGGACCACTGGGATCCCGCGCTGGTC
AACCCGTTGGCCGCCCGGCGCCCCGTCGTGCTGATAGACAACGCGGGCGTCGGGCGGTCGGGCGGCGAGGTGGCC
AAGACGTTCGCCGGCTGGGCGCGGCACTACGTCGACGTCATCCGCGCTCTCGGCATCGACCAGGCCGACCTCCTG
GGCTTCTCCATGGGCGGCTGCGTCGCGCAGATGGCGGCCCTCAACGCCCCGCGCCTCGTCCGTCGCCTCGTCCTC
TGCGGCACCATCCCCAGCGCGGGCGAGGGCGTGACGCGGGCGCCGCTGGGCCCCTTCAACCGGCTCAAGGCCGCC
GCCACGGCCGACGAGCAGCGCCAGGCCTTCCTCGATGCCTTCTTCACCCGCTCCGCCCGCAGCCAGGCGGCCGGC
AGGGCGGCCTGGGCGCGCATCAGCGCCGCCCGCCCGGCCAGGTCCCCGTCCCTCGGGCCCGAGGCCGCCCACAGG
CAGGCCGTCGCCTTCGCCAAGTTCATGGACCCGCGCCAGGCCCAGGACGCCTCCTTCGACCGCTTCGCCGAGCTC
GGCCTGCCGGTGCTGATTGCCAATGGGAGCGACGACCTGCTGCTGCCGACCGAAAACAGCATCGTCATGTGGAGG
AAGCTGAGCCATGCCGACGCCCAGCTGCACCTGTACCCGGACGCCGGCCATGGGTTCCTGTACCAGTACGCCGGG
CCCTTTGCAGCCCTCGTCAACCGCTTCCTCGACGCCGACGTCGACAGCCCCGAGGCAGCCCCCTCCAGCCGGCTG
TAG
Gene >Hirsu2|3247
ATGGCCACCTACGAGACGGCACCGGACCAGTTCGTCGACGTCGGCGGCATCCGATTCGCCTACCGCCGCTTCGGC
CGGCCGGCCGGCATCCCGCTCGTGCTCTTCATGCACTTCAGGTGATGAACCATTTCGACCCTCCCCCCCCCCGGC
CCTGCGCTGACGGTCGGCGCGCCCCAGGGGAACGATGGACCACTGGGATCCCGCGCTGGTCAACCCGTTGGCCGC
CCGGCGCCCCGTCGTGCTGATAGACAACGCGGGCGTCGGGCGGTCGGGCGGCGAGGTGGCCAAGACGTTCGCCGG
CTGGGCGCGGCACTACGTCGACGTCATCCGCGCTCTCGGCATCGACCAGGCCGACCTCCTGGGCTTCTCCATGGG
CGGCTGCGTCGCGCAGATGGCGGCCCTCAACGCCCCGCGCCTCGTCCGTCGCCTCGTCCTCTGCGGCACCATCCC
CAGCGCGGGCGAGGGCGTGACGCGGGCGCCGCTGGGCCCCTTCAACCGGCTCAAGGCCGCCGCCACGGCCGACGA
GCAGCGCCAGGCCTTCCTCGATGCCTTCTTCACCCGCTCCGCCCGCAGCCAGGCGGCCGGCAGGGCGGCCTGGGC
GCGCATCAGCGCCGCCCGCCCGGCCAGGTCCCCGTCCCTCGGGCCCGAGGCCGCCCACAGGCAGGCCGTCGCCTT
CGCCAAGTTCATGGACCCGCGCCAGGCCCAGGACGCCTCCTTCGACCGCTTCGCCGAGCTCGGCCTGCCGGTGCT
GATTGCCAATGGTGCGTGCAACAAATGTCTCGGCCTGAGCCCAGCTGCCCGCTGACGACGGCTGCGACAAAACAG
GGAGCGACGACCTGCTGCTGCCGACCGAAAACAGCATCGTCATGTGGAGGAAGCTGAGCCATGCCGACGCCCAGC
TGCACCTGTACCCGGACGCCGGCCATGGGTTCCTGTACCAGTACGCCGGGCCCTTTGCAGCCCTCGTCAACCGCT
TCCTCGACGCCGACGTCGACAGCCCCGAGGCAGCCCCCTCCAGCCGGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail