Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3245
Gene name
LocationContig_1830:316..960
Strand+
Gene length (bp)644
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01479 S4 S4 domain 7.3E-11 109 152
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 4.3E-10 4 63

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 2.0E-76
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-75
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-59
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 6.0E-56
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 2.0E-76
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-75
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-59
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 6.0E-56
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 3.0E-55
sp|Q3T0M3|IMP3_BOVIN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Bos taurus GN=IMP3 PE=2 SV=1 1 182 8.0E-55
sp|O01513|YS4L_CAEEL Putative 40S ribosomal protein S4-like OS=Caenorhabditis elegans GN=C48B6.2 PE=3 SV=1 1 183 3.0E-50
sp|A1RWT8|RS4_THEPD 30S ribosomal protein S4 OS=Thermofilum pendens (strain Hrk 5) GN=rps4 PE=3 SV=1 50 168 5.0E-11
sp|A2BK77|RS4_HYPBU 30S ribosomal protein S4 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4 PE=3 SV=1 28 164 2.0E-10
sp|A3DMQ4|RS4_STAMF 30S ribosomal protein S4 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4 PE=3 SV=1 62 170 4.0E-10
sp|Q96YV8|RS4_SULTO 30S ribosomal protein S4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4 PE=3 SV=1 61 169 2.0E-09
sp|Q5JJF2|RS4_THEKO 30S ribosomal protein S4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4 PE=3 SV=1 77 164 8.0E-09
sp|C5A251|RS4_THEGJ 30S ribosomal protein S4 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps4 PE=3 SV=1 77 164 1.0E-08
sp|P39467|RS4_SULAC 30S ribosomal protein S4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4 PE=3 SV=3 61 169 3.0E-08
sp|P61993|RS4_PYRFU 30S ribosomal protein S4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps4 PE=1 SV=1 76 161 3.0E-07
sp|P61992|RS4_PYRAB 30S ribosomal protein S4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps4 PE=3 SV=1 76 161 3.0E-07
sp|A8A8W3|RS4_IGNH4 30S ribosomal protein S4 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4 PE=3 SV=1 55 164 5.0E-07
sp|O59306|RS4_PYRHO 30S ribosomal protein S4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps4 PE=3 SV=1 76 161 7.0E-07
sp|O28000|RS4_ARCFU 30S ribosomal protein S4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4 PE=3 SV=1 46 160 1.0E-06
sp|C6A1B1|RS4_THESM 30S ribosomal protein S4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps4 PE=3 SV=1 77 160 1.0E-06
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 64 168 2.0E-06
sp|B6YSQ1|RS4_THEON 30S ribosomal protein S4 OS=Thermococcus onnurineus (strain NA1) GN=rps4 PE=3 SV=1 77 160 2.0E-06
sp|Q9YB58|RS4_AERPE 30S ribosomal protein S4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4 PE=3 SV=2 28 167 2.0E-06
sp|Q8TVC0|RS4_METKA 30S ribosomal protein S4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps4 PE=3 SV=1 29 167 4.0E-06
sp|A5UN53|RS4_METS3 30S ribosomal protein S4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps4 PE=3 SV=1 77 173 4.0E-06
sp|O26142|RS4_METTH 30S ribosomal protein S4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps4 PE=3 SV=1 35 175 7.0E-06
sp|Q74NF7|RS4_NANEQ 30S ribosomal protein S4 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps4 PE=3 SV=1 76 164 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0005622 intracellular Yes
GO:0019843 rRNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3245
MVRKLKYHEQKLLRKTDFITYKQDNQHRDKAVLRRYMIQKPEDYHKYNRLCGSLRQLAHRLSLLPAENATRRRLE
DQLLAKLHDMGVLPSRAKLSGVERGATVSAFARRRLPVVMTRLRMAETVQAATRLVEQGQVRVGVETVTDPAYLV
TRATEDFVTWVVGSKVKRNIMKYRDRLDDFELL*
Coding >Hirsu2|3245
ATGGTGCGCAAGCTCAAGTACCACGAGCAGAAGCTGCTGCGCAAGACCGACTTCATCACCTACAAGCAAGACAAC
CAGCACCGCGACAAGGCCGTGCTGCGGCGGTACATGATCCAGAAGCCCGAGGACTACCACAAGTACAACCGCCTC
TGCGGCTCGCTGCGACAACTGGCGCACCGGCTGTCGCTGCTGCCGGCCGAGAACGCGACGCGGCGCCGGCTCGAG
GACCAGCTGCTGGCGAAGCTGCACGACATGGGGGTGCTGCCGTCGCGGGCGAAGCTGTCGGGCGTGGAGCGCGGG
GCGACGGTCAGCGCGTTTGCGCGCCGTCGCCTGCCCGTCGTCATGACGCGCCTGCGCATGGCCGAGACGGTCCAG
GCCGCCACCCGCCTCGTCGAGCAGGGCCAGGTCCGCGTCGGCGTCGAGACCGTCACCGACCCGGCCTACCTCGTC
ACCCGCGCCACCGAGGACTTCGTCACCTGGGTCGTCGGCAGCAAGGTCAAGCGCAACATCATGAAGTACCGCGAC
CGCCTCGACGACTTTGAGCTGCTGTGA
Transcript >Hirsu2|3245
ATGGTGCGCAAGCTCAAGTACCACGAGCAGAAGCTGCTGCGCAAGACCGACTTCATCACCTACAAGCAAGACAAC
CAGCACCGCGACAAGGCCGTGCTGCGGCGGTACATGATCCAGAAGCCCGAGGACTACCACAAGTACAACCGCCTC
TGCGGCTCGCTGCGACAACTGGCGCACCGGCTGTCGCTGCTGCCGGCCGAGAACGCGACGCGGCGCCGGCTCGAG
GACCAGCTGCTGGCGAAGCTGCACGACATGGGGGTGCTGCCGTCGCGGGCGAAGCTGTCGGGCGTGGAGCGCGGG
GCGACGGTCAGCGCGTTTGCGCGCCGTCGCCTGCCCGTCGTCATGACGCGCCTGCGCATGGCCGAGACGGTCCAG
GCCGCCACCCGCCTCGTCGAGCAGGGCCAGGTCCGCGTCGGCGTCGAGACCGTCACCGACCCGGCCTACCTCGTC
ACCCGCGCCACCGAGGACTTCGTCACCTGGGTCGTCGGCAGCAAGGTCAAGCGCAACATCATGAAGTACCGCGAC
CGCCTCGACGACTTTGAGCTGCTGTGA
Gene >Hirsu2|3245
ATGGTGCGCAAGCTCAAGTACCACGAGCAGAAGCTGCTGCGCAAGACCGACTTCATCACCTACAAGCAAGACAAC
CAGCACCGCGACAAGGCCGTGCTGCGGCGGTACATGATCCAGAAGCCCGAGGACTACCACAAGTACAACCGCCTC
TGCGGCGTGAGTCTCTCCCCTTCCCCCCTCGACAGGAAGGAAAAGCCAAAAAAAGAGATGGTGTCTCTCTCTCTC
CCGTGCTCGCTGACACGGCCCAGTCGCTGCGACAACTGGCGCACCGGCTGTCGCTGCTGCCGGCCGAGAACGCGA
CGCGGCGCCGGCTCGAGGACCAGCTGCTGGCGAAGCTGCACGACATGGGGGTGCTGCCGTCGCGGGCGAAGCTGT
CGGGCGTGGAGCGCGGGGCGACGGTCAGCGCGTTTGCGCGCCGTCGCCTGCCCGTCGTCATGACGCGCCTGCGCA
TGGCCGAGACGGTCCAGGCCGCCACCCGCCTCGTCGAGCAGGGCCAGGTCCGCGTCGGCGTCGAGACCGTCACCG
ACCCGGCCTACCTCGTCACCCGCGCCACCGAGGACTTCGTCACCTGGGTCGTCGGCAGCAAGGTCAAGCGCAACA
TCATGAAGTACCGCGACCGCCTCGACGACTTTGAGCTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail