Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3240
Gene name
LocationContig_183:16340..18250
Strand+
Gene length (bp)1910
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-12 28 142
PF07690 MFS_1 Major Facilitator Superfamily 4.5E-13 204 482

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 85 107 22
4 117 139 22
5 205 227 22
6 242 264 22
7 341 363 22
8 395 417 22
9 424 446 22
10 461 483 22
11 536 558 22
12 568 585 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3240
MPSISRFLPFAASTTTVQAATYLLGVSLFSISFLVFLNSSVSFVITDLIGQKHNVGDVVGTLGFADELVALVACP
TWGLISDRLGVRWVATIGYAIIGLALAVFVQAKNVYPQLLLARMFFAVGASAAATMVTAILPSLTDEADDDATAV
SGSSRNKPNPRLSAAFSVESEVTITPERYSRSLSRERAHSPGQDAAAKSGKASALAGFVGAFTGCGALVALAVFL
PLPARFGGVDGVTPGEAVSYSFYVVGVVSLAVSLFVFFGLRNLKGEDGKGWRVLFGRQSRYHEVDNAEADDDGDD
GDDDDDDDNGEHRPRDKVVVPYLHLVRDSMRLGFTDPRIALGYLGGFVARASTVAVSLFIPLFVNTYFISNGFCR
GSPHDPSPELKKECRAAYVLSSVLTGVAQLVGLLCAPLFGYLSGRTGRVNYPVMAASALGMIGYIVLPHLSSPEI
KNVEGRGGSPVILVVVALIGISQIGAIVCSLGSLGQGVLAVELPRPARREPSIAPDDDESTESDPLVAASSTAGE
APSRVRLKGSIAGMYSLCGGAAILILTKVGGLLFDKLSHGAPFYMMAVFNGAWLVASLLMDASQVFSGA*
Coding >Hirsu2|3240
ATGCCGTCGATTTCGCGCTTCCTGCCGTTCGCGGCGTCGACAACGACGGTCCAGGCGGCGACGTATCTGCTCGGC
GTCTCGCTCTTCTCCATTTCCTTCCTCGTCTTCCTCAACAGCTCCGTCTCCTTTGTCATCACCGACCTGATCGGC
CAGAAGCACAACGTGGGCGACGTGGTCGGCACGCTGGGCTTCGCGGATGAGCTCGTCGCCCTGGTGGCTTGTCCC
ACGTGGGGGCTCATCTCGGACCGGCTCGGGGTTCGATGGGTGGCCACGATCGGCTACGCCATCATCGGCCTCGCC
CTGGCCGTCTTCGTCCAGGCCAAGAACGTCTACCCCCAGCTACTGCTGGCGCGCATGTTCTTCGCCGTCGGGGCC
TCGGCAGCCGCCACCATGGTCACGGCCATACTCCCCTCCCTGACGGACGAGGCCGACGACGACGCCACAGCCGTG
TCCGGATCGTCGAGGAACAAGCCAAACCCGCGACTCAGCGCGGCCTTTTCCGTCGAGTCCGAAGTCACCATCACC
CCGGAGAGGTATAGCCGAAGCCTGTCGCGCGAACGCGCACACAGCCCCGGCCAGGACGCCGCGGCCAAGTCGGGA
AAAGCCTCGGCCCTGGCCGGCTTTGTAGGCGCCTTCACGGGCTGCGGCGCTCTCGTGGCGCTGGCCGTCTTCTTG
CCGCTACCGGCGAGGTTCGGCGGTGTCGACGGTGTGACTCCCGGGGAGGCTGTGTCGTACAGCTTCTACGTCGTC
GGAGTCGTCTCTCTGGCCGTCTCTCTCTTCGTCTTCTTCGGCCTGCGCAATCTGAAGGGCGAAGACGGCAAGGGC
TGGAGAGTGCTTTTCGGCCGACAAAGTCGCTACCACGAGGTGGACAATGCCGAAGCGGACGACGACGGCGACGAC
GGCGACGACGACGACGACGACGACAACGGCGAGCACCGGCCGCGAGACAAGGTTGTGGTCCCGTACCTCCATCTC
GTGCGAGACTCGATGCGGCTGGGGTTTACCGACCCGCGGATCGCGCTGGGCTACCTCGGCGGCTTTGTCGCCAGG
GCCTCTACGGTGGCCGTCTCTCTTTTCATTCCCTTGTTTGTCAACACGTACTTCATCAGCAACGGCTTCTGCCGG
GGCTCACCCCACGACCCGTCGCCGGAGCTCAAGAAGGAATGCCGAGCGGCCTATGTCCTGTCGTCGGTCCTGACG
GGCGTCGCGCAGCTCGTGGGCCTACTGTGCGCCCCGCTCTTTGGCTACCTCTCGGGTCGCACCGGAAGGGTCAAC
TATCCCGTCATGGCGGCGAGTGCCCTGGGCATGATTGGCTATATCGTCCTGCCGCACCTCTCGAGCCCCGAGATC
AAGAACGTGGAGGGGCGCGGGGGCAGCCCGGTCATCCTCGTCGTCGTCGCCCTGATCGGCATCAGCCAGATCGGG
GCCATTGTCTGCAGCCTGGGGTCGCTGGGCCAGGGCGTGCTGGCCGTCGAGCTGCCGCGGCCGGCGCGGCGCGAG
CCATCGATCGCGCCGGACGACGACGAGTCCACCGAGTCGGACCCTCTGGTGGCGGCGAGCTCGACGGCGGGCGAG
GCCCCGTCGCGGGTACGGCTGAAGGGGTCCATCGCCGGAATGTATTCGCTGTGCGGGGGCGCCGCCATCCTGATC
TTGACCAAGGTCGGCGGGCTCCTGTTCGACAAGCTGTCGCACGGGGCGCCCTTTTACATGATGGCCGTCTTCAAC
GGGGCTTGGCTCGTGGCCAGCCTGCTGATGGACGCGTCGCAGGTCTTCTCGGGGGCGTGA
Transcript >Hirsu2|3240
ATGCCGTCGATTTCGCGCTTCCTGCCGTTCGCGGCGTCGACAACGACGGTCCAGGCGGCGACGTATCTGCTCGGC
GTCTCGCTCTTCTCCATTTCCTTCCTCGTCTTCCTCAACAGCTCCGTCTCCTTTGTCATCACCGACCTGATCGGC
CAGAAGCACAACGTGGGCGACGTGGTCGGCACGCTGGGCTTCGCGGATGAGCTCGTCGCCCTGGTGGCTTGTCCC
ACGTGGGGGCTCATCTCGGACCGGCTCGGGGTTCGATGGGTGGCCACGATCGGCTACGCCATCATCGGCCTCGCC
CTGGCCGTCTTCGTCCAGGCCAAGAACGTCTACCCCCAGCTACTGCTGGCGCGCATGTTCTTCGCCGTCGGGGCC
TCGGCAGCCGCCACCATGGTCACGGCCATACTCCCCTCCCTGACGGACGAGGCCGACGACGACGCCACAGCCGTG
TCCGGATCGTCGAGGAACAAGCCAAACCCGCGACTCAGCGCGGCCTTTTCCGTCGAGTCCGAAGTCACCATCACC
CCGGAGAGGTATAGCCGAAGCCTGTCGCGCGAACGCGCACACAGCCCCGGCCAGGACGCCGCGGCCAAGTCGGGA
AAAGCCTCGGCCCTGGCCGGCTTTGTAGGCGCCTTCACGGGCTGCGGCGCTCTCGTGGCGCTGGCCGTCTTCTTG
CCGCTACCGGCGAGGTTCGGCGGTGTCGACGGTGTGACTCCCGGGGAGGCTGTGTCGTACAGCTTCTACGTCGTC
GGAGTCGTCTCTCTGGCCGTCTCTCTCTTCGTCTTCTTCGGCCTGCGCAATCTGAAGGGCGAAGACGGCAAGGGC
TGGAGAGTGCTTTTCGGCCGACAAAGTCGCTACCACGAGGTGGACAATGCCGAAGCGGACGACGACGGCGACGAC
GGCGACGACGACGACGACGACGACAACGGCGAGCACCGGCCGCGAGACAAGGTTGTGGTCCCGTACCTCCATCTC
GTGCGAGACTCGATGCGGCTGGGGTTTACCGACCCGCGGATCGCGCTGGGCTACCTCGGCGGCTTTGTCGCCAGG
GCCTCTACGGTGGCCGTCTCTCTTTTCATTCCCTTGTTTGTCAACACGTACTTCATCAGCAACGGCTTCTGCCGG
GGCTCACCCCACGACCCGTCGCCGGAGCTCAAGAAGGAATGCCGAGCGGCCTATGTCCTGTCGTCGGTCCTGACG
GGCGTCGCGCAGCTCGTGGGCCTACTGTGCGCCCCGCTCTTTGGCTACCTCTCGGGTCGCACCGGAAGGGTCAAC
TATCCCGTCATGGCGGCGAGTGCCCTGGGCATGATTGGCTATATCGTCCTGCCGCACCTCTCGAGCCCCGAGATC
AAGAACGTGGAGGGGCGCGGGGGCAGCCCGGTCATCCTCGTCGTCGTCGCCCTGATCGGCATCAGCCAGATCGGG
GCCATTGTCTGCAGCCTGGGGTCGCTGGGCCAGGGCGTGCTGGCCGTCGAGCTGCCGCGGCCGGCGCGGCGCGAG
CCATCGATCGCGCCGGACGACGACGAGTCCACCGAGTCGGACCCTCTGGTGGCGGCGAGCTCGACGGCGGGCGAG
GCCCCGTCGCGGGTACGGCTGAAGGGGTCCATCGCCGGAATGTATTCGCTGTGCGGGGGCGCCGCCATCCTGATC
TTGACCAAGGTCGGCGGGCTCCTGTTCGACAAGCTGTCGCACGGGGCGCCCTTTTACATGATGGCCGTCTTCAAC
GGGGCTTGGCTCGTGGCCAGCCTGCTGATGGACGCGTCGCAGGTCTTCTCGGGGGCGTGA
Gene >Hirsu2|3240
ATGCCGTCGATTTCGCGCTTCCTGCCGTTCGCGGCGTCGACAACGACGGTCCAGGCGGCGACGTATCTGCTCGGC
GTCTCGCTCTTCTCCATTTCCTTCCTCGTCTTCCTCAACAGCTCCGTCTCCTTTGTCATCACCGACCTGATCGGC
CAGAAGCACAACGTGGGCGACGTGGTCGGCACGCTGGGCTTCGCGGATGAGCTCGTCGCCCTGGTGGCTTGTCCC
ACGTGGGGGCTCATCTCGGACCGGCTCGGGGTTCGATGGGTGGCCACGATCGGCTACGCCATCATCGGCCTCGCC
CTGGCCGTCTTCGTCCAGGCCAAGAACGTCTACCCCCAGCTACTGCTGGCGCGCATGTTCTTCGCCGTCGGGGCC
TCGGCAGCGTGAGTGTGGCGAAATCCATCCGAGGCTGCGTCCGCGAGCTGACAGCTCTCAGCGCCACCATGGTCA
CGGCCATACTCCCCTCCCTGACGGACGAGGCCGACGACGACGCCACAGCCGTGTCCGGATCGTCGAGGAACAAGC
CAAACCCGCGACTCAGCGCGGCCTTTTCCGTCGAGTCCGAAGTCACCATCACCCCGGAGAGGTATAGCCGAAGCC
TGTCGCGCGAACGCGCACACAGCCCCGGCCAGGACGCCGCGGCCAAGTCGGGAAAAGCCTCGGCCCTGGCCGGCT
TTGTAGGCGCCTTCACGGGCTGCGGCGCTCTCGTGGCGCTGGCCGTCTTCTTGCCGCTACCGGCGAGGTTCGGCG
GTGTCGACGGTGTGACTCCCGGGGAGGCTGTGTCGTACAGCTTCTACGTCGTCGGAGTCGTCTCTCTGGCCGTCT
CTCTCTTCGTCTTCTTCGGCCTGCGCAATCTGAAGGGCGAAGACGGCAAGGGCTGGAGAGTGCTTTTCGGCCGAC
AAAGTCGCTACCACGAGGTGGACAATGCCGAAGCGGACGACGACGGCGACGACGGCGACGACGACGACGACGACG
ACAACGGCGAGCACCGGCCGCGAGACAAGGTAGGCAGGCAGGCTCTCCGGAAATTGGCGACGGTCCGCCCGCCCG
ACTTGTTGCTGACCGCCAAGATGCAGGTTGTGGTCCCGTACCTCCATCTCGTGCGAGACTCGATGCGGCTGGGGT
TTACCGACCCGCGGATCGCGCTGGGCTACCTCGGCGGCTTTGTCGCCAGGGCCTCTACGGTGGCCGTCTCTCTTT
TCATTCCCTTGTTTGTCAACACGTACTTCATCAGCAACGGCTTCTGCCGGGGCTCACCCCACGACCCGTCGCCGG
AGCTCAAGAAGGAATGCCGAGCGGCCTATGTCCTGTCGTCGGTCCTGACGGGCGTCGCGCAGCTCGTGGGCCTAC
TGTGCGCCCCGCTCTTTGGCTACCTCTCGGGTCGCACCGGAAGGGTCAACTATCCCGTCATGGCGGCGAGTGCCC
TGGGCATGATTGGCTATATCGTCCTGCCGCACCTCTCGAGCCCCGAGATCAAGAACGTGGAGGGGCGCGGGGGCA
GCCCGGTCATCCTCGTCGTCGTCGCCCTGATCGGCATCAGCCAGATCGGGGCCATTGTCTGCAGCCTGGGGTCGC
TGGGCCAGGGCGTGCTGGCCGTCGAGCTGCCGCGGCCGGCGCGGCGCGAGCCATCGATCGCGCCGGACGACGACG
AGTCCACCGAGTCGGACCCTCTGGTGGCGGCGAGCTCGACGGCGGGCGAGGCCCCGTCGCGGGTACGGCTGAAGG
GGTCCATCGCCGGAATGTATTCGCTGTGCGGGGGCGCCGCCATCCTGATCTTGACCAAGGTCGGCGGGCTCCTGT
TCGACAAGCTGTCGCACGGGGCGCCCTTTTACATGATGGCCGTCTTCAACGGGGCTTGGCTCGTGGCCAGCCTGC
TGATGGACGCGTCGCAGGTCTTCTCGGGGGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail