Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|324
Gene name
LocationContig_1061:4687..6445
Strand-
Gene length (bp)1758
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 1.0E-28 8 177
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 2.1E-18 204 302
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 1.2E-15 414 503

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51844|PDC_ASPPA Pyruvate decarboxylase OS=Aspergillus parasiticus GN=pdcA PE=3 SV=1 4 571 0.0E+00
sp|Q4WXX9|PDC_ASPFU Pyruvate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdcA PE=3 SV=1 5 571 1.0E-133
sp|Q2UKV4|PDC_ASPOR Pyruvate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdcA PE=3 SV=1 5 571 7.0E-130
sp|Q0CNV1|PDC_ASPTN Pyruvate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pdcA PE=3 SV=1 5 585 6.0E-128
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 1 572 1.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51844|PDC_ASPPA Pyruvate decarboxylase OS=Aspergillus parasiticus GN=pdcA PE=3 SV=1 4 571 0.0E+00
sp|Q4WXX9|PDC_ASPFU Pyruvate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdcA PE=3 SV=1 5 571 1.0E-133
sp|Q2UKV4|PDC_ASPOR Pyruvate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdcA PE=3 SV=1 5 571 7.0E-130
sp|Q0CNV1|PDC_ASPTN Pyruvate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pdcA PE=3 SV=1 5 585 6.0E-128
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 1 572 1.0E-127
sp|P87208|PDC_EMENI Pyruvate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pdcA PE=3 SV=3 5 571 4.0E-125
sp|P34734|PDC_HANUV Pyruvate decarboxylase OS=Hanseniaspora uvarum GN=PDC PE=3 SV=1 3 585 3.0E-123
sp|P83779|PDC1_CANAL Pyruvate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDC11 PE=1 SV=2 3 583 1.0E-122
sp|P26263|PDC6_YEAST Pyruvate decarboxylase isozyme 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC6 PE=1 SV=3 3 585 8.0E-122
sp|Q12629|PDC1_KLULA Pyruvate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PDC1 PE=1 SV=2 3 585 3.0E-121
sp|P06169|PDC1_YEAST Pyruvate decarboxylase isozyme 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC1 PE=1 SV=7 3 585 6.0E-121
sp|Q6FJA3|PDC1_CANGA Pyruvate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDC1 PE=3 SV=1 3 585 1.0E-120
sp|P33149|PDC1_KLUMA Pyruvate decarboxylase OS=Kluyveromyces marxianus GN=PDC1 PE=3 SV=1 3 585 1.0E-118
sp|P16467|PDC5_YEAST Pyruvate decarboxylase isozyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC5 PE=1 SV=4 3 585 6.0E-118
sp|Q07471|THI3_YEAST Thiamine metabolism regulatory protein THI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI3 PE=1 SV=1 1 575 8.0E-115
sp|O42873|PDC4_SCHPO Putative pyruvate decarboxylase C3G9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3G9.11c PE=3 SV=1 5 572 1.0E-114
sp|Q742Q2|KDC_MYCPA Alpha-keto-acid decarboxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kdc PE=3 SV=1 10 572 2.0E-102
sp|A0QBE6|KDC_MYCA1 Alpha-keto-acid decarboxylase OS=Mycobacterium avium (strain 104) GN=kdc PE=3 SV=2 10 572 4.0E-102
sp|Q9CBD6|KDC_MYCLE Alpha-keto-acid decarboxylase OS=Mycobacterium leprae (strain TN) GN=kdc PE=3 SV=1 7 572 2.0E-100
sp|P23234|DCIP_ENTCL Indole-3-pyruvate decarboxylase OS=Enterobacter cloacae GN=ipdC PE=1 SV=1 7 585 1.0E-99
sp|P9WG36|KDC_MYCTO Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdc PE=3 SV=1 10 572 1.0E-96
sp|P9WG37|KDC_MYCTU Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdc PE=1 SV=1 10 572 2.0E-96
sp|A5U0P1|KDC_MYCTA Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kdc PE=3 SV=1 10 572 2.0E-96
sp|A1KGY5|KDC_MYCBP Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kdc PE=3 SV=1 10 572 2.0E-96
sp|Q7U140|KDC_MYCBO Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdc PE=3 SV=1 10 572 2.0E-96
sp|A0PL16|KDC_MYCUA Alpha-keto-acid decarboxylase OS=Mycobacterium ulcerans (strain Agy99) GN=kdc PE=3 SV=1 10 571 7.0E-94
sp|A0R480|KDC_MYCS2 Alpha-keto-acid decarboxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kdc PE=3 SV=1 10 571 9.0E-93
sp|Q06408|ARO10_YEAST Transaminated amino acid decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO10 PE=1 SV=1 3 572 4.0E-83
sp|A2XFI3|PDC2_ORYSI Pyruvate decarboxylase 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2 7 572 6.0E-67
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 3 572 6.0E-67
sp|Q10MW3|PDC2_ORYSJ Pyruvate decarboxylase 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1 7 572 1.0E-66
sp|Q92345|PDC2_SCHPO Probable pyruvate decarboxylase C1F8.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F8.07c PE=1 SV=3 3 569 2.0E-66
sp|Q9M039|PDC3_ARATH Pyruvate decarboxylase 3 OS=Arabidopsis thaliana GN=PDC3 PE=2 SV=1 3 572 2.0E-66
sp|A2Y5L9|PDC1_ORYSI Pyruvate decarboxylase 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1 7 572 4.0E-64
sp|Q0DHF6|PDC1_ORYSJ Pyruvate decarboxylase 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1 7 572 8.0E-64
sp|O82647|PDC1_ARATH Pyruvate decarboxylase 1 OS=Arabidopsis thaliana GN=PDC1 PE=2 SV=1 7 572 9.0E-64
sp|Q9FFT4|PDC2_ARATH Pyruvate decarboxylase 2 OS=Arabidopsis thaliana GN=PDC2 PE=2 SV=1 2 572 5.0E-62
sp|P28516|PDC1_MAIZE Pyruvate decarboxylase 1 OS=Zea mays GN=PDC1 PE=2 SV=1 7 572 5.0E-62
sp|P51850|PDC1_PEA Pyruvate decarboxylase 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1 2 572 7.0E-62
sp|P51846|PDC2_TOBAC Pyruvate decarboxylase 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 7 572 2.0E-61
sp|A2YQ76|PDC3_ORYSI Pyruvate decarboxylase 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=3 SV=2 7 572 1.0E-60
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 2 572 9.0E-60
sp|Q0D3D2|PDC3_ORYSJ Pyruvate decarboxylase 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1 7 572 1.0E-59
sp|P33287|PDC_NEUCR Pyruvate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfp PE=1 SV=1 10 572 5.0E-59
sp|P06672|PDC_ZYMMO Pyruvate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdc PE=1 SV=1 7 569 4.0E-57
sp|P51852|DCIP_AZOBR Indole-3-pyruvate decarboxylase OS=Azospirillum brasilense GN=ipdC PE=1 SV=1 5 579 4.0E-45
sp|P51845|PDC1_TOBAC Pyruvate decarboxylase 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1 57 499 2.0E-37
sp|P51851|PDC2_PEA Pyruvate decarboxylase 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1 162 572 1.0E-23
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 10 497 1.0E-20
sp|Q05327|PDC3_MAIZE Pyruvate decarboxylase 3 (Fragment) OS=Zea mays GN=PDC3 PE=2 SV=1 378 572 5.0E-17
sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=1 SV=1 15 497 2.0E-15
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 25 530 1.0E-13
sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 42 497 2.0E-12
sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 42 322 3.0E-12
sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvB PE=3 SV=2 15 495 7.0E-12
sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 42 322 1.0E-11
sp|Q84H44|XSC_CASDE Sulfoacetaldehyde acetyltransferase OS=Castellaniella defragrans GN=xsc PE=1 SV=3 19 502 1.0E-10
sp|Q7U5G1|ILVB_SYNPX Acetolactate synthase large subunit OS=Synechococcus sp. (strain WH8102) GN=ilvB PE=3 SV=1 2 495 2.0E-10
sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 15 515 4.0E-07
sp|Q9LCV9|CEAS_STRCL N(2)-(2-carboxyethyl)arginine synthase OS=Streptomyces clavuligerus GN=ceaS PE=1 SV=1 34 530 7.0E-07
sp|D5AKX8|XSC_RHOCB Sulfoacetaldehyde acetyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=xsc PE=2 SV=1 15 310 2.0E-06
sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 15 289 3.0E-06
sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 15 289 5.0E-06
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 11 497 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|324
MPSTVPLAAYLFGRLRQLGLGSVHGVPGDFNLALLDHLEPAGLRWVGNANELNAAYAADAYARVRGLAALVTTFG
VGELSAVNAIAGAYSERAAVVHIVGVPSREAQDARLLLHHGLNDGDYRRFARVHALFTVAQTRLWDPRTGPRQID
DVLRQCLAASRPVYIEVPVDLVPLPVPDAALRLPIESCRRRDPLPPDPTRDTVVADVVARMRGAARPIILVDGEV
RPMGIVDDVQRLVKRTGWPTWTSPFGKGLLDETAPGFHGVYRGAFADAAARTAFDEADLILCFGPHLSWSNTYGF
SSVPRIEVTIFFTDAEVRLCGETFRDVPAQYIAPRLAEALEPSTMVSCKPCRALHMHQPIGTSNGRPPSPVSACA
SDDAPLVHDGLWTSLSCFLRPGDIVLGDTGTSGYGVREMRLPKHARLFTHVTWLSVGYMLPGAQGAALAQRELVE
SDDYFGIQDARTILFVGDGAFQMTAQELATIIRHELDVVVFLVNNDGYTVERCIHGRSQAYNDIPRWRYLQAPAF
FGAAEDTFTASVKTWAELATVLADERLRDGKGLRMVELVLDREDVPKGPLSECLEAQKNA*
Coding >Hirsu2|324
ATGCCGTCGACTGTCCCGCTCGCGGCCTACCTCTTCGGTCGGCTGCGCCAGCTCGGCCTTGGCTCCGTTCACGGC
GTTCCCGGCGACTTCAACCTGGCCCTGCTCGATCACCTCGAGCCGGCCGGCCTGCGCTGGGTCGGCAACGCCAAC
GAGCTCAACGCGGCCTACGCCGCCGACGCCTATGCCCGCGTCCGCGGCCTTGCCGCCCTGGTCACCACCTTCGGC
GTCGGCGAGCTCTCGGCCGTCAACGCCATCGCCGGCGCCTACTCCGAGCGCGCGGCTGTCGTTCACATCGTCGGC
GTGCCGTCCCGCGAGGCCCAGGACGCCCGGCTCCTGCTCCACCACGGACTCAACGACGGCGACTACCGCCGCTTC
GCCCGGGTGCACGCTCTCTTCACCGTTGCTCAGACTCGCCTCTGGGACCCGCGCACCGGCCCGCGCCAGATCGAC
GACGTCCTGCGTCAGTGCCTCGCCGCAAGCCGGCCCGTCTACATTGAGGTGCCCGTCGACCTGGTGCCGCTGCCC
GTCCCTGATGCGGCGCTCCGGCTGCCCATTGAGTCGTGCCGCCGCCGTGATCCGTTGCCGCCGGACCCGACTCGC
GACACCGTCGTGGCCGATGTCGTCGCCCGCATGCGCGGCGCGGCGCGGCCCATCATCCTCGTCGACGGCGAGGTC
CGACCCATGGGAATCGTCGACGACGTTCAGCGGCTTGTCAAGAGGACCGGCTGGCCCACTTGGACCTCGCCGTTC
GGCAAGGGTCTGCTGGACGAGACGGCGCCCGGCTTCCACGGCGTCTACCGAGGCGCATTCGCCGACGCCGCGGCC
CGGACCGCCTTCGACGAAGCCGACCTGATCCTGTGCTTCGGCCCTCACCTCAGCTGGAGCAACACGTACGGCTTC
TCCAGCGTTCCCCGCATCGAAGTCACCATCTTCTTCACTGACGCCGAGGTCCGGCTCTGCGGCGAGACGTTTCGC
GATGTTCCCGCGCAGTATATCGCACCCCGACTCGCCGAGGCCCTCGAACCGTCCACGATGGTCTCCTGCAAGCCT
TGCCGTGCCCTGCACATGCATCAGCCCATCGGCACATCCAATGGGCGTCCCCCTTCGCCCGTCTCTGCGTGTGCG
AGCGACGACGCGCCGCTCGTCCACGATGGGCTGTGGACCAGCCTCTCCTGCTTCCTCCGGCCCGGCGACATCGTG
CTTGGAGACACGGGCACGTCGGGCTACGGCGTGCGCGAAATGCGCCTGCCGAAGCACGCCCGCCTCTTCACGCAC
GTCACCTGGCTGTCTGTCGGCTACATGCTTCCGGGGGCCCAAGGGGCGGCCTTGGCCCAGCGGGAGCTGGTCGAG
TCCGACGACTACTTTGGCATCCAGGACGCGCGCACGATCCTCTTCGTTGGCGACGGGGCCTTCCAGATGACAGCC
CAGGAGCTGGCGACGATTATCCGGCACGAGCTCGACGTTGTCGTCTTCCTCGTCAACAACGACGGGTACACCGTC
GAGAGGTGCATCCACGGCCGGAGCCAGGCCTACAATGACATCCCCCGCTGGCGATATCTGCAGGCCCCGGCCTTC
TTCGGGGCCGCCGAGGATACCTTTACGGCCTCGGTCAAGACTTGGGCCGAGCTGGCCACCGTACTGGCGGACGAG
CGACTCCGGGACGGGAAGGGGCTGAGGATGGTAGAGCTAGTATTGGACAGAGAGGACGTGCCCAAGGGCCCGTTA
TCGGAATGCCTGGAAGCTCAAAAGAATGCCTGA
Transcript >Hirsu2|324
ATGCCGTCGACTGTCCCGCTCGCGGCCTACCTCTTCGGTCGGCTGCGCCAGCTCGGCCTTGGCTCCGTTCACGGC
GTTCCCGGCGACTTCAACCTGGCCCTGCTCGATCACCTCGAGCCGGCCGGCCTGCGCTGGGTCGGCAACGCCAAC
GAGCTCAACGCGGCCTACGCCGCCGACGCCTATGCCCGCGTCCGCGGCCTTGCCGCCCTGGTCACCACCTTCGGC
GTCGGCGAGCTCTCGGCCGTCAACGCCATCGCCGGCGCCTACTCCGAGCGCGCGGCTGTCGTTCACATCGTCGGC
GTGCCGTCCCGCGAGGCCCAGGACGCCCGGCTCCTGCTCCACCACGGACTCAACGACGGCGACTACCGCCGCTTC
GCCCGGGTGCACGCTCTCTTCACCGTTGCTCAGACTCGCCTCTGGGACCCGCGCACCGGCCCGCGCCAGATCGAC
GACGTCCTGCGTCAGTGCCTCGCCGCAAGCCGGCCCGTCTACATTGAGGTGCCCGTCGACCTGGTGCCGCTGCCC
GTCCCTGATGCGGCGCTCCGGCTGCCCATTGAGTCGTGCCGCCGCCGTGATCCGTTGCCGCCGGACCCGACTCGC
GACACCGTCGTGGCCGATGTCGTCGCCCGCATGCGCGGCGCGGCGCGGCCCATCATCCTCGTCGACGGCGAGGTC
CGACCCATGGGAATCGTCGACGACGTTCAGCGGCTTGTCAAGAGGACCGGCTGGCCCACTTGGACCTCGCCGTTC
GGCAAGGGTCTGCTGGACGAGACGGCGCCCGGCTTCCACGGCGTCTACCGAGGCGCATTCGCCGACGCCGCGGCC
CGGACCGCCTTCGACGAAGCCGACCTGATCCTGTGCTTCGGCCCTCACCTCAGCTGGAGCAACACGTACGGCTTC
TCCAGCGTTCCCCGCATCGAAGTCACCATCTTCTTCACTGACGCCGAGGTCCGGCTCTGCGGCGAGACGTTTCGC
GATGTTCCCGCGCAGTATATCGCACCCCGACTCGCCGAGGCCCTCGAACCGTCCACGATGGTCTCCTGCAAGCCT
TGCCGTGCCCTGCACATGCATCAGCCCATCGGCACATCCAATGGGCGTCCCCCTTCGCCCGTCTCTGCGTGTGCG
AGCGACGACGCGCCGCTCGTCCACGATGGGCTGTGGACCAGCCTCTCCTGCTTCCTCCGGCCCGGCGACATCGTG
CTTGGAGACACGGGCACGTCGGGCTACGGCGTGCGCGAAATGCGCCTGCCGAAGCACGCCCGCCTCTTCACGCAC
GTCACCTGGCTGTCTGTCGGCTACATGCTTCCGGGGGCCCAAGGGGCGGCCTTGGCCCAGCGGGAGCTGGTCGAG
TCCGACGACTACTTTGGCATCCAGGACGCGCGCACGATCCTCTTCGTTGGCGACGGGGCCTTCCAGATGACAGCC
CAGGAGCTGGCGACGATTATCCGGCACGAGCTCGACGTTGTCGTCTTCCTCGTCAACAACGACGGGTACACCGTC
GAGAGGTGCATCCACGGCCGGAGCCAGGCCTACAATGACATCCCCCGCTGGCGATATCTGCAGGCCCCGGCCTTC
TTCGGGGCCGCCGAGGATACCTTTACGGCCTCGGTCAAGACTTGGGCCGAGCTGGCCACCGTACTGGCGGACGAG
CGACTCCGGGACGGGAAGGGGCTGAGGATGGTAGAGCTAGTATTGGACAGAGAGGACGTGCCCAAGGGCCCGTTA
TCGGAATGCCTGGAAGCTCAAAAGAATGCCTGA
Gene >Hirsu2|324
ATGCCGTCGACTGTCCCGCTCGCGGCCTACCTCTTCGGTCGGCTGCGCCAGCTCGGCCTTGGCTCCGTTCACGGC
GTTCCCGGCGACTTCAACCTGGCCCTGCTCGATCACCTCGAGCCGGCCGGCCTGCGCTGGGTCGGCAACGCCAAC
GAGCTCAACGCGGCCTACGCCGCCGACGCCTATGCCCGCGTCCGCGGCCTTGCCGCCCTGGTCACCACCTTCGGC
GTCGGCGAGCTCTCGGCCGTCAACGCCATCGCCGGCGCCTACTCCGAGCGCGCGGCTGTCGTTCACATCGTCGGC
GTGCCGTCCCGCGAGGCCCAGGACGCCCGGCTCCTGCTCCACCACGGACTCAACGACGGCGACTACCGCCGCTTC
GCCCGGGTGCACGCTCTCTTCACCGTTGCTCAGACTCGCCTCTGGGACCCGCGCACCGGCCCGCGCCAGATCGAC
GACGTCCTGCGTCAGTGCCTCGCCGCAAGCCGGCCCGTCTACATTGAGGTGCCCGTCGACCTGGTGCCGCTGCCC
GTCCCTGATGCGGCGCTCCGGCTGCCCATTGAGTCGTGCCGCCGCCGTGATCCGTTGCCGCCGGACCCGACTCGC
GACACCGTCGTGGCCGATGTCGTCGCCCGCATGCGCGGCGCGGCGCGGCCCATCATCCTCGTCGACGGCGAGGTC
CGACCCATGGGAATCGTCGACGACGTTCAGCGGCTTGTCAAGAGGACCGGCTGGCCCACTTGGACCTCGCCGTTC
GGCAAGGGTCTGCTGGACGAGACGGCGCCCGGCTTCCACGGCGTCTACCGAGGCGCATTCGCCGACGCCGCGGCC
CGGACCGCCTTCGACGAAGCCGACCTGATCCTGTGCTTCGGCCCTCACCTCAGCTGGAGCAACACGTACGGCTTC
TCCAGCGTTCCCCGCATCGAAGTCACCATCTTCTTCACTGACGCCGAGGTCCGGCTCTGCGGCGAGACGTTTCGC
GATGTTCCCGCGCAGTATATCGCACCCCGACTCGCCGAGGCCCTCGAACCGTCCACGATGGTCTCCTGCAAGCCT
TGCCGTGCCCTGCACATGCATCAGCCCATCGGCACATCCAATGGGCGTCCCCCTTCGCCCGTCTCTGCGTGTGCG
AGCGACGACGCGCCGCTCGTCCACGATGGGCTGTGGACCAGCCTCTCCTGCTTCCTCCGGCCCGGCGACATCGTG
CTTGGAGACACGGGCACGTCGGGCTACGGCGTGCGCGAAATGCGCCTGCCGAAGCACGCCCGCCTCTTCACGCAC
GTCACCTGGCTGTCTGTCGGCTACATGCTTCCGGGGGCCCAAGGGGCGGCCTTGGCCCAGCGGGAGCTGGTCGAG
TCCGACGACTACTTTGGCATCCAGGACGCGCGCACGATCCTCTTCGTTGGCGACGGGGCCTTCCAGATGACAGCC
CAGGAGCTGGCGACGATTATCCGGCACGAGCTCGACGTTGTCGTCTTCCTCGTCAACAACGACGGGTACACCGTC
GAGAGGTGCATCCACGGCCGGAGCCAGGCCTACAATGACATCCCCCGCTGGCGATATCTGCAGGCCCCGGCCTTC
TTCGGGGCCGCCGAGGATACCTTTACGGCCTCGGTCAAGACTTGGGCCGAGCTGGCCACCGTACTGGCGGACGAG
CGACTCCGGGACGGGAAGGGGCTGAGGATGGTAGAGCTAGTATTGGACAGAGAGGACGTGCCCAAGGGCCCGTTA
TCGGAATGCCTGGAAGCTCAAAAGAATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail