Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3239
Gene name
LocationContig_183:13320..15703
Strand+
Gene length (bp)2383
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 6.6E-18 103 420
PF00022 Actin Actin 1.8E-06 655 744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US07|ARP8_SCHPO Probable actin-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.02c PE=1 SV=2 22 532 2.0E-97
sp|Q12386|ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP8 PE=1 SV=1 33 469 2.0E-76
sp|Q5RDA1|ARP8_PONAB Actin-related protein 8 OS=Pongo abelii GN=ACTR8 PE=2 SV=1 107 749 1.0E-65
sp|Q9H981|ARP8_HUMAN Actin-related protein 8 OS=Homo sapiens GN=ACTR8 PE=1 SV=2 107 749 5.0E-64
sp|D2I1E3|ARP8_AILME Actin-related protein 8 OS=Ailuropoda melanoleuca GN=ACTR8 PE=3 SV=1 107 749 6.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US07|ARP8_SCHPO Probable actin-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.02c PE=1 SV=2 22 532 2.0E-97
sp|Q12386|ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP8 PE=1 SV=1 33 469 2.0E-76
sp|Q5RDA1|ARP8_PONAB Actin-related protein 8 OS=Pongo abelii GN=ACTR8 PE=2 SV=1 107 749 1.0E-65
sp|Q9H981|ARP8_HUMAN Actin-related protein 8 OS=Homo sapiens GN=ACTR8 PE=1 SV=2 107 749 5.0E-64
sp|D2I1E3|ARP8_AILME Actin-related protein 8 OS=Ailuropoda melanoleuca GN=ACTR8 PE=3 SV=1 107 749 6.0E-64
sp|B5X2S3|ARP8_SALSA Actin-related protein 8 OS=Salmo salar GN=actr8 PE=2 SV=1 107 749 9.0E-64
sp|P59679|ARP8_DANRE Actin-related protein 8 OS=Danio rerio GN=actr8 PE=2 SV=1 60 469 8.0E-52
sp|Q1LZF2|ARP8_BOVIN Actin-related protein 8 OS=Bos taurus GN=ACTR8 PE=2 SV=1 107 469 8.0E-52
sp|Q8R2S9|ARP8_MOUSE Actin-related protein 8 OS=Mus musculus GN=Actr8 PE=2 SV=1 107 469 2.0E-51
sp|Q29G73|ARP8_DROPS Actin-related protein 8 OS=Drosophila pseudoobscura pseudoobscura GN=Arp8 PE=3 SV=2 102 749 2.0E-46
sp|Q0IEG8|ARP8_AEDAE Actin-related protein 8 OS=Aedes aegypti GN=Arp8 PE=3 SV=1 107 469 1.0E-42
sp|Q9VX09|ARP8_DROME Actin-related protein 8 OS=Drosophila melanogaster GN=Arp8 PE=1 SV=1 102 482 7.0E-33
sp|A2XQX0|ARP9_ORYSI Actin-related protein 9 OS=Oryza sativa subsp. indica GN=ARP9 PE=3 SV=2 105 418 2.0E-26
sp|Q0JF03|ARP9_ORYSJ Actin-related protein 9 OS=Oryza sativa subsp. japonica GN=ARP9 PE=2 SV=1 105 418 7.0E-26
sp|Q9LSW2|ARP9_ARATH Actin-related protein 9 OS=Arabidopsis thaliana GN=ARP9 PE=2 SV=1 105 469 2.0E-22
sp|Q54JV5|ARP8_DICDI Actin-related protein 8 OS=Dictyostelium discoideum GN=arpG PE=3 SV=1 237 387 1.0E-21
sp|Q9US07|ARP8_SCHPO Probable actin-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.02c PE=1 SV=2 636 749 3.0E-12
sp|Q0IEG8|ARP8_AEDAE Actin-related protein 8 OS=Aedes aegypti GN=Arp8 PE=3 SV=1 614 749 3.0E-11
sp|Q8R2S9|ARP8_MOUSE Actin-related protein 8 OS=Mus musculus GN=Actr8 PE=2 SV=1 639 749 6.0E-09
sp|Q1LZF2|ARP8_BOVIN Actin-related protein 8 OS=Bos taurus GN=ACTR8 PE=2 SV=1 639 749 1.0E-08
sp|Q9VX09|ARP8_DROME Actin-related protein 8 OS=Drosophila melanogaster GN=Arp8 PE=1 SV=1 636 749 4.0E-07
sp|P59679|ARP8_DANRE Actin-related protein 8 OS=Danio rerio GN=actr8 PE=2 SV=1 639 749 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3239
MVGKVSERVLLREGLERTDNGMKLTSWPEVTPINQKNYYTDYMKRDDQVLALRLQSDATRDRLVQTARDRDRLLS
KPANGELPLPVPDLAEDDGAVTPSGAVDPSRIIVIHPGSQNLRIGFASDALPKTIPMTIGTRFPKTESDMYEALP
RRKFEAKTADQQYGEEWTKKYHRMCGELKTEMRANKRKVLPNSKELVQTYNRRTEPELIEKHNDPLEIEWTDIKT
LEDPDSPTSCFIGNDALRVPDDSDPKFKLWWPIRYGWWNEDDYSSQEHLYDDFESLLDRALRQELGLRTNSEWQQ
YNCVFVIPDLYDKRYVEQILRSCMTWFEFSRVCFVQESMAATFGAGYTQACVVDVGAQKTSVTCVEDGLCIEDSR
VNLKYGGYDITETFVKMMLYDNFPYQEINLRRRYDFLLAEELKMKHCTMSQADISVQLYQFHVRAPSQPTRKYSF
KTYDEVILAAMGVFEPSIFDNSVKLRGRRKLVERSYNAYDVDFPDDPSSAAQLAILALVKPSLTSSSNGPPQQSQ
PEVSTPSKERTQPFNFLGRGEAGTNGTPAVSHAGSPAPEGSSTPIPPPYVFGSGKDGANCDSPAPSGTRAAGTPV
PGQASQASQPPPGIFVDGPERSATSVAAERDGVLPVAPLDIAILTSIQNAAKGDEKKLRDLLGSIMVIGGGSKIA
QFTVVLEEKLKTRRPDLTDRILVSRSARDMDEQVVAWKGASVFSKLPTNDSWITPFEFERLGSRTLHHKVLWAW*
Coding >Hirsu2|3239
ATGGTCGGCAAGGTCTCCGAGAGGGTCCTTCTCCGGGAGGGGCTGGAGAGGACCGACAATGGCATGAAGCTGACG
AGCTGGCCCGAGGTCACGCCCATCAACCAAAAAAACTATTACACCGATTACATGAAGCGCGACGACCAGGTTCTC
GCCCTCCGACTCCAGAGTGATGCGACGCGCGATCGTCTCGTCCAAACCGCCCGCGACCGCGACCGACTCCTCTCC
AAGCCAGCAAATGGCGAGCTGCCCCTCCCGGTCCCCGATCTCGCGGAGGATGACGGTGCCGTCACGCCCTCGGGC
GCAGTGGACCCCTCGAGGATAATCGTCATTCATCCTGGCAGCCAGAACTTGCGCATTGGCTTCGCCAGCGACGCT
CTGCCCAAGACCATACCCATGACGATCGGGACAAGGTTTCCCAAGACGGAATCTGACATGTACGAGGCGCTCCCT
CGGCGGAAGTTCGAGGCCAAGACAGCCGACCAACAATACGGGGAGGAGTGGACCAAGAAATATCATCGAATGTGC
GGCGAGCTCAAGACCGAGATGCGTGCCAACAAGCGCAAGGTGCTGCCCAACTCCAAGGAACTCGTCCAGACGTAC
AATCGGCGAACGGAGCCTGAATTGATCGAGAAGCACAACGACCCTCTGGAGATCGAGTGGACCGACATCAAGACG
CTCGAGGACCCGGACTCTCCTACGTCTTGCTTCATCGGCAACGACGCCTTGCGCGTGCCCGACGACTCGGATCCA
AAGTTCAAGCTTTGGTGGCCGATCCGGTACGGGTGGTGGAACGAAGACGACTACTCGAGCCAAGAGCACCTCTAC
GACGACTTTGAGAGTCTCTTGGACAGGGCGCTGCGGCAGGAGCTTGGCCTCAGGACGAACAGCGAGTGGCAGCAG
TACAACTGCGTCTTCGTCATCCCGGACCTGTACGACAAGCGTTACGTCGAACAGATTCTGCGCTCCTGCATGACG
TGGTTCGAATTCAGCAGGGTATGCTTCGTGCAGGAGAGCATGGCTGCCACCTTCGGCGCCGGATACACGCAAGCC
TGCGTCGTCGACGTGGGGGCCCAGAAGACGTCGGTGACGTGCGTGGAAGATGGCCTCTGCATCGAGGATTCGAGG
GTGAACCTCAAGTACGGCGGCTACGACATCACGGAGACGTTCGTCAAGATGATGCTGTACGACAACTTTCCATAT
CAGGAGATCAATCTGCGGAGGCGTTATGACTTTCTGCTGGCCGAGGAGCTCAAGATGAAGCACTGCACCATGTCC
CAGGCCGACATTTCGGTGCAGCTATATCAGTTTCACGTCCGCGCGCCCAGTCAGCCCACGAGGAAGTACAGCTTC
AAGACGTATGACGAGGTCATCCTGGCCGCCATGGGCGTTTTCGAGCCGTCCATCTTCGACAACAGCGTCAAGCTG
CGGGGTCGGCGCAAGCTGGTCGAGCGGTCGTACAATGCCTACGACGTCGACTTTCCCGACGACCCGTCCTCGGCG
GCGCAGCTGGCGATACTGGCGCTGGTGAAGCCGTCGCTCACGTCGAGCAGCAACGGACCTCCGCAGCAGTCACAG
CCAGAAGTGTCGACGCCCAGCAAGGAGAGGACGCAGCCGTTCAACTTCCTCGGAAGGGGCGAGGCCGGCACGAAC
GGTACGCCCGCAGTCTCGCACGCCGGCTCGCCGGCGCCGGAGGGAAGCAGCACGCCCATCCCCCCGCCGTACGTC
TTTGGATCCGGCAAGGACGGTGCCAACTGCGACAGCCCGGCGCCGAGCGGGACCCGAGCCGCCGGCACTCCGGTC
CCTGGGCAAGCGTCGCAGGCGTCGCAGCCGCCGCCGGGAATATTTGTCGACGGCCCGGAGCGGAGTGCGACGTCG
GTAGCGGCGGAGAGGGACGGCGTGCTCCCGGTGGCGCCGCTGGACATTGCCATCCTCACGAGCATCCAGAACGCC
GCTAAGGGCGACGAGAAGAAGCTGCGTGACCTCTTGGGGAGCATCATGGTCATAGGAGGGGGCTCCAAGATTGCC
CAGTTCACGGTCGTGTTGGAGGAGAAGCTGAAGACGCGGCGGCCCGACCTGACGGATAGGATCTTGGTGAGCAGG
AGCGCCAGGGACATGGACGAACAGGTGGTGGCGTGGAAGGGGGCCAGCGTCTTCTCCAAACTGCCGACGAACGAC
TCGTGGATCACGCCCTTCGAGTTCGAACGGCTGGGCTCGAGGACTCTTCACCACAAGGTGCTGTGGGCCTGGTGA
Transcript >Hirsu2|3239
ATGGTCGGCAAGGTCTCCGAGAGGGTCCTTCTCCGGGAGGGGCTGGAGAGGACCGACAATGGCATGAAGCTGACG
AGCTGGCCCGAGGTCACGCCCATCAACCAAAAAAACTATTACACCGATTACATGAAGCGCGACGACCAGGTTCTC
GCCCTCCGACTCCAGAGTGATGCGACGCGCGATCGTCTCGTCCAAACCGCCCGCGACCGCGACCGACTCCTCTCC
AAGCCAGCAAATGGCGAGCTGCCCCTCCCGGTCCCCGATCTCGCGGAGGATGACGGTGCCGTCACGCCCTCGGGC
GCAGTGGACCCCTCGAGGATAATCGTCATTCATCCTGGCAGCCAGAACTTGCGCATTGGCTTCGCCAGCGACGCT
CTGCCCAAGACCATACCCATGACGATCGGGACAAGGTTTCCCAAGACGGAATCTGACATGTACGAGGCGCTCCCT
CGGCGGAAGTTCGAGGCCAAGACAGCCGACCAACAATACGGGGAGGAGTGGACCAAGAAATATCATCGAATGTGC
GGCGAGCTCAAGACCGAGATGCGTGCCAACAAGCGCAAGGTGCTGCCCAACTCCAAGGAACTCGTCCAGACGTAC
AATCGGCGAACGGAGCCTGAATTGATCGAGAAGCACAACGACCCTCTGGAGATCGAGTGGACCGACATCAAGACG
CTCGAGGACCCGGACTCTCCTACGTCTTGCTTCATCGGCAACGACGCCTTGCGCGTGCCCGACGACTCGGATCCA
AAGTTCAAGCTTTGGTGGCCGATCCGGTACGGGTGGTGGAACGAAGACGACTACTCGAGCCAAGAGCACCTCTAC
GACGACTTTGAGAGTCTCTTGGACAGGGCGCTGCGGCAGGAGCTTGGCCTCAGGACGAACAGCGAGTGGCAGCAG
TACAACTGCGTCTTCGTCATCCCGGACCTGTACGACAAGCGTTACGTCGAACAGATTCTGCGCTCCTGCATGACG
TGGTTCGAATTCAGCAGGGTATGCTTCGTGCAGGAGAGCATGGCTGCCACCTTCGGCGCCGGATACACGCAAGCC
TGCGTCGTCGACGTGGGGGCCCAGAAGACGTCGGTGACGTGCGTGGAAGATGGCCTCTGCATCGAGGATTCGAGG
GTGAACCTCAAGTACGGCGGCTACGACATCACGGAGACGTTCGTCAAGATGATGCTGTACGACAACTTTCCATAT
CAGGAGATCAATCTGCGGAGGCGTTATGACTTTCTGCTGGCCGAGGAGCTCAAGATGAAGCACTGCACCATGTCC
CAGGCCGACATTTCGGTGCAGCTATATCAGTTTCACGTCCGCGCGCCCAGTCAGCCCACGAGGAAGTACAGCTTC
AAGACGTATGACGAGGTCATCCTGGCCGCCATGGGCGTTTTCGAGCCGTCCATCTTCGACAACAGCGTCAAGCTG
CGGGGTCGGCGCAAGCTGGTCGAGCGGTCGTACAATGCCTACGACGTCGACTTTCCCGACGACCCGTCCTCGGCG
GCGCAGCTGGCGATACTGGCGCTGGTGAAGCCGTCGCTCACGTCGAGCAGCAACGGACCTCCGCAGCAGTCACAG
CCAGAAGTGTCGACGCCCAGCAAGGAGAGGACGCAGCCGTTCAACTTCCTCGGAAGGGGCGAGGCCGGCACGAAC
GGTACGCCCGCAGTCTCGCACGCCGGCTCGCCGGCGCCGGAGGGAAGCAGCACGCCCATCCCCCCGCCGTACGTC
TTTGGATCCGGCAAGGACGGTGCCAACTGCGACAGCCCGGCGCCGAGCGGGACCCGAGCCGCCGGCACTCCGGTC
CCTGGGCAAGCGTCGCAGGCGTCGCAGCCGCCGCCGGGAATATTTGTCGACGGCCCGGAGCGGAGTGCGACGTCG
GTAGCGGCGGAGAGGGACGGCGTGCTCCCGGTGGCGCCGCTGGACATTGCCATCCTCACGAGCATCCAGAACGCC
GCTAAGGGCGACGAGAAGAAGCTGCGTGACCTCTTGGGGAGCATCATGGTCATAGGAGGGGGCTCCAAGATTGCC
CAGTTCACGGTCGTGTTGGAGGAGAAGCTGAAGACGCGGCGGCCCGACCTGACGGATAGGATCTTGGTGAGCAGG
AGCGCCAGGGACATGGACGAACAGGTGGTGGCGTGGAAGGGGGCCAGCGTCTTCTCCAAACTGCCGACGAACGAC
TCGTGGATCACGCCCTTCGAGTTCGAACGGCTGGGCTCGAGGACTCTTCACCACAAGGTGCTGTGGGCCTGGTGA
Gene >Hirsu2|3239
ATGGTCGGCAAGGTCTCCGAGAGGGTCCTTCTCCGGGAGGGCAAGCCGATCCCCTCCCCGTGTGCGCTCCAGGCG
ACTTTGCGCTGACTTTGACATCCGGGCAGGGCTGGAGAGGACCGACAATGGCATGAAGCTGACGAGCTGGCCCGA
GGTCACGCCCATCAACCAAAAAAACTATTACACGTGAGTCTCGGCCGTGGCACGGCGTCTGCGAGTGCGAGAGCG
ATGGAGACTGACACGGGCCTTCGTTAGCGATTACATGAAGCGCGACGACCAGGTTCTCGCCCTCCGACTCCAGAG
TGATGCGACGCGCGATCGTCTCGTCCAAACCGCCCGCGACCGCGACCGACTCCTCTCCAAGCCAGCAAATGGCGA
GCTGCCCCTCCCGGTCCCCGATCTCGCGGAGGATGACGGTGCCGTCACGCCCTCGGGCGCAGTGGACCCCTCGAG
GATAATCGTCATTCATCCTGGCAGCCAGAACTTGCGCATTGGCTTCGCCAGCGACGCTCTGCCCAAGACCATACC
CATGACGATCGGGACAAGGTTTCCCAAGACGGAATCTGACATGTACGAGGCGCTCCCTCGGCGGAAGTTCGAGGC
CAAGACAGCCGACCAACAATACGGGGAGGAGTGGACCAAGAAATATCATCGAATGTGCGGCGAGCTCAAGACCGA
GATGCGTGCCAACAAGCGCAAGGTGCTGCCCAACTCCAAGGAACTCGTCCAGACGTACAATCGGCGAACGGAGCC
TGAATTGATCGAGAAGCACAACGACCCTCTGGAGATCGAGTGGACCGACATCAAGACGCTCGAGGACCCGGACTC
TCCTACGTCTTGCTTCATCGGCAACGACGCCTTGCGCGTGCCCGACGACTCGGATCCAAAGTTCAAGCTTTGGTG
GCCGATCCGGTACGGGTGGTGGAACGAAGACGACTACTCGAGCCAAGAGCACCTCTACGACGACTTTGAGAGTCT
CTTGGACAGGGCGCTGCGGCAGGAGCTTGGCCTCAGGACGAACAGCGAGTGGCAGCAGTACAACTGCGTCTTCGT
CATCCCGGACCTGTACGACAAGCGTTACGTCGAACAGATTCTGCGCTCCTGCATGACGTGGTTCGAATTCAGCAG
GGTATGCTTCGTGCAGGAGAGCATGGCTGCCACCTTCGGCGCCGGATACACGCAAGCCTGCGTCGTCGACGTGGG
GGCCCAGAAGACGTCGGTGACGTGCGTGGAAGATGGCCTCTGCATCGAGGATTCGAGGGTGAACCTCAAGTACGG
CGGCTACGACATCACGGAGACGTTCGTCAAGATGATGCTGTACGACAACTTTCCATATCAGGAGATCAATCTGCG
GAGGCGTTATGACTTTCTGCTGGCCGAGGAGCTCAAGATGAAGCACTGCACCATGTCCCAGGCCGACATTTCGGT
GCAGCTATATCAGTTTCACGTCCGCGCGCCCAGTCAGCCCACGAGGAAGTACAGCTTCAAGACGTATGACGAGGT
CATCCTGGCCGCCATGGGCGTTTTCGAGCCGTCCATCTTCGACAACAGCGTCAAGCTGCGGGGTCGGCGCAAGCT
GGTCGAGCGGTCGTACAATGCCTACGACGTCGACTTTCCCGACGACCCGTCCTCGGCGGCGCAGCTGGCGATACT
GGCGCTGGTGAAGCCGTCGCTCACGTCGAGCAGCAACGGACCTCCGCAGCAGTCACAGCCAGAAGTGTCGACGCC
CAGCAAGGAGAGGACGCAGCCGTTCAACTTCCTCGGAAGGGGCGAGGCCGGCACGAACGGTACGCCCGCAGTCTC
GCACGCCGGCTCGCCGGCGCCGGAGGGAAGCAGCACGCCCATCCCCCCGCCGTACGTCTTTGGATCCGGCAAGGA
CGGTGCCAACTGCGACAGCCCGGCGCCGAGCGGGACCCGAGCCGCCGGCACTCCGGTCCCTGGGCAAGCGTCGCA
GGCGTCGCAGCCGCCGCCGGGAATATTTGTCGACGGCCCGGAGCGGAGTGCGACGTCGGTAGCGGCGGAGAGGGA
CGGCGTGCTCCCGGTGGCGCCGCTGGACATTGCCATCCTCACGAGCATCCAGAACGCCGCTAAGGGCGACGAGAA
GAAGCTGCGTGACCTCTTGGGGAGCATCATGGTCATAGGAGGGGGCTCCAAGATTGCCCAGTTCACGGTCGTGTT
GGAGGAGAAGCTGAAGACGCGGCGGCCCGACCTGACGGATAGGATCTTGGTGAGCAGGAGCGCCAGGGACATGGA
CGAACAGGTGGTGGCGTGGAAGGGGGCCAGCGTCTTCTCCAAACTGCCGACGAACGACTCGTGGATCACGCCCTT
CGAGTTCGAACGGCTGGGCTCGAGGACTCTTCACCACAAGGTGCTGTGGGCCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail