Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3220
Gene name
LocationContig_1822:537..4713
Strand+
Gene length (bp)4176
Transcript length (bp)3813
Coding sequence length (bp)3813
Protein length (aa) 1271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6567 0.1515 0.2365 0.3697 0.0657 0.0029 0.1075 0.1241 0.1416 0.0142

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1086
Ophiocordyceps australis map64 (Brazil) OphauB2|1106
Ophiocordyceps camponoti-floridani Ophcf2|01733
Ophiocordyceps camponoti-rufipedis Ophun1|3088
Ophiocordyceps kimflemingae Ophio5|7467
Ophiocordyceps subramaniannii Hirsu2|3220 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3220
MSLNGLDDPTIVDAHETATSEPGGWFLLKYSNRDEVQLLSRGNGGIVEMRSAVSNYDETSPLYGFLKYRRRNVVI
KYLPEDCSRLIQARVAVHFNAICERFSPYDAMFEITTPGELIDTKLSLACSLHAASCSTSSSSSSLRRRRLMEIA
EEEEEEQRASKRQSIEEPTYDRPRSPAASSAADPVALDSHLAAFPEHSKFSAYSTLELPTFVGADNRPTSSAKSM
DVDPNLSYASFPYGKPKVKLGPRPSLEVSGRPRTAGNFRPISAIPAGFKLFGKGSKKAKKDRNSTIVASQEAPAS
VTSDPSAIATSEDVQPARGKAASLHASSGVSADLSLMPPTQSTSTKKPAVSPEKARLMKAMQLRQKKKMMDLRSH
SDAHSLNDLPPEAGELDHTAHKTEMGPESEHKEDHLAQADDGAVAAPASSSAHTDQTSDLTQTDSRPVSPLVALS
EADQSTKASSLSESTHETPRAEDRAPALGNGATLRIPPKDNANDDEHAPAAHAPRSETAPLRVSEGKADEGAPES
PREAAPASEARAAGARRPQNEPAEKSDAEAANLAAAPNPSTAATELLSAPQAISDRSTSSQNEGEKHKITSLPIS
KFSVVDIPPSPKLPQEAVPSHADPETPEIPAPTSAGDATTTDASEDPASRQQNLSISPTSPQASAAPTTVIAASV
ASFGTSQPPPVSVQTNSSDRAPQQIASEADSTAAQRGQPKRKGHIEPIRTDLAQHSRQTSHSGANFSDDEELMEE
LRSATLQEAKPMLVAKTPVSTTFSTSPTKGRAAANAHVVRTVSNPVRGNLTAPTDPQQPQQPQQQQLQLPGASLV
RKSNIGGSSVSQRIKALEKLSAATGDGGAANSRERPSSTFFAVKKREPSRSPSVMERANSLRRGIPDSRPQSKDS
SSESGRVSRQERSGSVSDRLSIFEAPTGANALSRPPSSSRRGRPESVSVTAKIVRDSSQGLQTGLEPPRDPSEYS
RLELKQSPLVVDRQTAIPEVVPAPAAKPAAERRSASEERAKPIKSRQSSLSIVKDFIKERRKSVTSNQGDASAAA
ASSRSPSRSPPVQQGSTFSPRLSISSHRSSLSRDRDSVTSPTGESFGGDDGKSANGDKKLSRAGRFMRRLSNLSG
SRSKNSPTGIAHAVAEEVPEPEIPRPATTGSPTVVSYMGDVNVQFPDTLLWKRRNLSLDSQGFLILNALPAQSGR
QALGIKRYHLSEFRPPYIPDVEIQELPNSVVLDFIEGASIQIACEDRAGQANVLGILREAHGTRGSTYGL*
Coding >Hirsu2|3220
ATGTCGCTCAACGGCCTGGACGATCCAACGATCGTCGACGCTCACGAGACGGCCACTTCGGAACCGGGAGGATGG
TTTCTGCTCAAGTACTCCAACAGGGACGAGGTCCAACTGTTGAGCCGTGGCAATGGGGGTATTGTGGAAATGCGC
AGCGCTGTGTCCAACTACGATGAGACGAGCCCGCTCTATGGTTTCTTAAAGTATCGCAGGAGGAACGTCGTAATC
AAGTACCTCCCGGAGGACTGCTCCCGGCTGATACAAGCTCGCGTAGCCGTGCACTTCAATGCCATCTGCGAACGC
TTCTCCCCCTACGATGCCATGTTCGAAATCACCACACCGGGCGAGCTCATAGACACCAAGCTGTCTCTGGCCTGC
TCTCTGCACGCCGCCTCCTGCTCGACTTCGTCCTCCAGCAGCTCCTTGCGCAGACGACGTCTGATGGAGATCGCC
GAAGAGGAGGAGGAAGAGCAGCGTGCCTCCAAGCGCCAGTCCATTGAGGAACCGACATACGATCGACCTCGGTCG
CCGGCAGCCTCCTCAGCCGCAGATCCTGTGGCTCTCGATTCCCATCTCGCTGCCTTCCCGGAGCACAGCAAGTTT
TCGGCCTATTCAACCTTAGAACTGCCGACCTTCGTTGGTGCCGACAATCGGCCGACATCCTCCGCCAAATCAATG
GATGTCGATCCCAACCTCAGCTACGCGTCGTTCCCGTACGGCAAGCCCAAGGTGAAATTGGGACCCCGTCCATCG
CTCGAAGTGAGCGGCCGGCCGCGGACTGCCGGCAACTTCCGCCCCATTTCGGCCATCCCGGCCGGCTTTAAGCTC
TTCGGCAAGGGCAGCAAGAAGGCCAAGAAGGACCGCAATAGCACTATAGTAGCCTCTCAGGAAGCACCCGCTAGC
GTCACATCAGACCCTTCCGCCATCGCCACGTCCGAAGATGTCCAACCGGCGCGAGGGAAAGCTGCTTCGCTTCAC
GCGAGCTCCGGCGTTTCTGCGGATCTCTCCCTGATGCCGCCGACACAGTCGACATCGACGAAAAAACCGGCCGTA
TCTCCCGAAAAAGCGAGGCTGATGAAGGCCATGCAATTGAGACAGAAGAAGAAGATGATGGACCTGAGATCACAC
AGTGACGCACATTCTCTCAACGACCTACCACCAGAGGCCGGCGAGTTGGACCACACGGCGCACAAGACGGAAATG
GGCCCCGAATCCGAGCACAAGGAAGACCACCTTGCACAAGCCGACGACGGAGCTGTAGCGGCCCCCGCGTCGTCC
TCGGCGCACACCGATCAGACATCAGATCTTACACAGACCGATTCGCGACCAGTCAGCCCTTTGGTGGCCCTGTCT
GAGGCGGACCAGTCCACTAAGGCGTCATCACTCTCAGAATCGACTCATGAGACACCAAGGGCGGAGGACCGGGCA
CCCGCGCTAGGCAACGGCGCGACACTACGAATCCCGCCGAAAGACAACGCGAACGATGATGAGCACGCACCGGCT
GCCCATGCCCCTCGATCAGAGACTGCGCCCTTGCGGGTCTCCGAGGGAAAGGCTGACGAGGGGGCTCCTGAAAGC
CCTCGCGAGGCCGCCCCTGCTTCAGAAGCCAGGGCGGCTGGTGCCCGACGGCCGCAAAACGAACCCGCCGAAAAA
TCGGACGCCGAAGCCGCGAACCTTGCCGCCGCGCCGAATCCATCAACCGCTGCCACCGAGCTACTTTCAGCTCCT
CAAGCCATCTCGGATCGGAGCACAAGCTCCCAAAACGAAGGCGAGAAGCACAAGATTACCTCACTCCCGATATCA
AAGTTCTCCGTCGTCGACATTCCACCGTCGCCCAAGCTCCCTCAGGAAGCGGTACCGAGCCACGCGGACCCCGAG
ACGCCAGAAATTCCAGCGCCGACGTCCGCCGGGGACGCGACAACAACAGACGCGAGCGAGGACCCCGCTTCTCGA
CAGCAGAACCTTTCCATCTCTCCGACCTCACCGCAAGCCTCTGCAGCTCCTACAACGGTAATCGCTGCTTCAGTC
GCATCGTTCGGGACATCGCAGCCGCCGCCCGTGAGCGTTCAAACCAATTCCTCGGACCGCGCTCCTCAGCAGATC
GCAAGCGAGGCAGACTCGACGGCCGCTCAACGAGGCCAGCCGAAACGAAAGGGACATATCGAGCCCATCCGGACC
GACCTCGCACAGCACAGTCGCCAGACGTCACACTCTGGGGCCAATTTCTCGGACGACGAGGAGCTGATGGAAGAG
CTGCGGAGTGCGACACTGCAAGAAGCGAAGCCAATGTTGGTGGCCAAGACTCCCGTTTCAACGACCTTCTCGACC
AGTCCCACCAAGGGGAGGGCGGCAGCAAACGCACATGTGGTGCGCACCGTTTCCAACCCCGTTCGGGGTAACCTC
ACGGCGCCGACAGACCCACAGCAGCCACAGCAGCCCCAACAACAACAGCTGCAGCTGCCGGGCGCGAGCCTGGTC
AGGAAGTCGAACATTGGAGGATCCAGCGTCTCCCAGCGCATCAAAGCGCTGGAGAAGCTGTCCGCCGCCACGGGA
GATGGAGGAGCGGCCAATTCGCGGGAGCGGCCGTCGTCGACCTTCTTCGCCGTCAAGAAGCGGGAACCGTCGAGG
TCCCCATCCGTCATGGAGCGGGCCAACTCGCTCCGGCGAGGTATACCGGACTCGCGTCCACAATCCAAGGATTCC
TCGTCCGAGTCCGGGAGAGTGAGCCGACAGGAACGATCCGGATCGGTGTCAGACCGGCTCTCCATATTCGAGGCG
CCAACGGGCGCCAATGCCTTGAGCCGCCCGCCCAGCAGCTCCAGGCGCGGTCGCCCGGAGTCGGTCTCGGTCACG
GCCAAGATCGTCCGGGATTCGAGCCAGGGCTTGCAGACCGGCCTCGAGCCGCCCAGGGATCCGTCCGAGTACAGC
CGCCTCGAGCTGAAGCAGTCGCCCCTGGTGGTGGACCGTCAGACTGCGATCCCGGAGGTCGTTCCGGCGCCGGCG
GCGAAGCCAGCTGCGGAGCGTCGGTCCGCTTCCGAGGAACGGGCCAAGCCGATCAAATCGCGGCAGTCGTCGCTG
AGCATAGTCAAGGATTTCATCAAAGAGCGCCGTAAGTCGGTCACGTCGAACCAGGGAGACGCTTCGGCCGCGGCC
GCCTCGTCGCGCTCGCCGTCGCGCTCGCCTCCCGTGCAGCAGGGTAGCACCTTCTCCCCCCGCCTATCCATAAGC
AGCCATCGGTCGTCACTCAGCCGGGACCGCGACAGCGTCACGTCGCCGACCGGGGAGAGCTTCGGGGGGGACGAC
GGCAAGTCGGCCAACGGGGACAAGAAGCTGTCCCGAGCCGGGCGATTCATGCGCCGTCTATCTAATCTGTCCGGG
TCGCGCAGCAAGAACTCGCCGACGGGCATCGCGCACGCAGTGGCCGAGGAGGTCCCCGAGCCCGAGATTCCGAGG
CCGGCGACGACCGGGTCGCCGACGGTCGTCTCGTACATGGGCGACGTCAACGTGCAGTTTCCGGACACGCTGCTC
TGGAAGCGCAGGAACCTCAGCCTCGACTCGCAGGGATTCCTCATCCTGAACGCGCTGCCGGCCCAGAGCGGCCGG
CAGGCCCTGGGCATCAAGCGGTACCACCTCAGCGAGTTCCGGCCGCCGTACATACCGGACGTCGAGATCCAGGAG
CTGCCCAACAGCGTGGTGCTGGACTTCATCGAGGGCGCCAGCATCCAGATCGCGTGCGAGGACCGGGCGGGCCAG
GCGAACGTGCTAGGCATTCTCCGCGAGGCCCACGGCACGCGTGGCTCTACATACGGTCTCTGA
Transcript >Hirsu2|3220
ATGTCGCTCAACGGCCTGGACGATCCAACGATCGTCGACGCTCACGAGACGGCCACTTCGGAACCGGGAGGATGG
TTTCTGCTCAAGTACTCCAACAGGGACGAGGTCCAACTGTTGAGCCGTGGCAATGGGGGTATTGTGGAAATGCGC
AGCGCTGTGTCCAACTACGATGAGACGAGCCCGCTCTATGGTTTCTTAAAGTATCGCAGGAGGAACGTCGTAATC
AAGTACCTCCCGGAGGACTGCTCCCGGCTGATACAAGCTCGCGTAGCCGTGCACTTCAATGCCATCTGCGAACGC
TTCTCCCCCTACGATGCCATGTTCGAAATCACCACACCGGGCGAGCTCATAGACACCAAGCTGTCTCTGGCCTGC
TCTCTGCACGCCGCCTCCTGCTCGACTTCGTCCTCCAGCAGCTCCTTGCGCAGACGACGTCTGATGGAGATCGCC
GAAGAGGAGGAGGAAGAGCAGCGTGCCTCCAAGCGCCAGTCCATTGAGGAACCGACATACGATCGACCTCGGTCG
CCGGCAGCCTCCTCAGCCGCAGATCCTGTGGCTCTCGATTCCCATCTCGCTGCCTTCCCGGAGCACAGCAAGTTT
TCGGCCTATTCAACCTTAGAACTGCCGACCTTCGTTGGTGCCGACAATCGGCCGACATCCTCCGCCAAATCAATG
GATGTCGATCCCAACCTCAGCTACGCGTCGTTCCCGTACGGCAAGCCCAAGGTGAAATTGGGACCCCGTCCATCG
CTCGAAGTGAGCGGCCGGCCGCGGACTGCCGGCAACTTCCGCCCCATTTCGGCCATCCCGGCCGGCTTTAAGCTC
TTCGGCAAGGGCAGCAAGAAGGCCAAGAAGGACCGCAATAGCACTATAGTAGCCTCTCAGGAAGCACCCGCTAGC
GTCACATCAGACCCTTCCGCCATCGCCACGTCCGAAGATGTCCAACCGGCGCGAGGGAAAGCTGCTTCGCTTCAC
GCGAGCTCCGGCGTTTCTGCGGATCTCTCCCTGATGCCGCCGACACAGTCGACATCGACGAAAAAACCGGCCGTA
TCTCCCGAAAAAGCGAGGCTGATGAAGGCCATGCAATTGAGACAGAAGAAGAAGATGATGGACCTGAGATCACAC
AGTGACGCACATTCTCTCAACGACCTACCACCAGAGGCCGGCGAGTTGGACCACACGGCGCACAAGACGGAAATG
GGCCCCGAATCCGAGCACAAGGAAGACCACCTTGCACAAGCCGACGACGGAGCTGTAGCGGCCCCCGCGTCGTCC
TCGGCGCACACCGATCAGACATCAGATCTTACACAGACCGATTCGCGACCAGTCAGCCCTTTGGTGGCCCTGTCT
GAGGCGGACCAGTCCACTAAGGCGTCATCACTCTCAGAATCGACTCATGAGACACCAAGGGCGGAGGACCGGGCA
CCCGCGCTAGGCAACGGCGCGACACTACGAATCCCGCCGAAAGACAACGCGAACGATGATGAGCACGCACCGGCT
GCCCATGCCCCTCGATCAGAGACTGCGCCCTTGCGGGTCTCCGAGGGAAAGGCTGACGAGGGGGCTCCTGAAAGC
CCTCGCGAGGCCGCCCCTGCTTCAGAAGCCAGGGCGGCTGGTGCCCGACGGCCGCAAAACGAACCCGCCGAAAAA
TCGGACGCCGAAGCCGCGAACCTTGCCGCCGCGCCGAATCCATCAACCGCTGCCACCGAGCTACTTTCAGCTCCT
CAAGCCATCTCGGATCGGAGCACAAGCTCCCAAAACGAAGGCGAGAAGCACAAGATTACCTCACTCCCGATATCA
AAGTTCTCCGTCGTCGACATTCCACCGTCGCCCAAGCTCCCTCAGGAAGCGGTACCGAGCCACGCGGACCCCGAG
ACGCCAGAAATTCCAGCGCCGACGTCCGCCGGGGACGCGACAACAACAGACGCGAGCGAGGACCCCGCTTCTCGA
CAGCAGAACCTTTCCATCTCTCCGACCTCACCGCAAGCCTCTGCAGCTCCTACAACGGTAATCGCTGCTTCAGTC
GCATCGTTCGGGACATCGCAGCCGCCGCCCGTGAGCGTTCAAACCAATTCCTCGGACCGCGCTCCTCAGCAGATC
GCAAGCGAGGCAGACTCGACGGCCGCTCAACGAGGCCAGCCGAAACGAAAGGGACATATCGAGCCCATCCGGACC
GACCTCGCACAGCACAGTCGCCAGACGTCACACTCTGGGGCCAATTTCTCGGACGACGAGGAGCTGATGGAAGAG
CTGCGGAGTGCGACACTGCAAGAAGCGAAGCCAATGTTGGTGGCCAAGACTCCCGTTTCAACGACCTTCTCGACC
AGTCCCACCAAGGGGAGGGCGGCAGCAAACGCACATGTGGTGCGCACCGTTTCCAACCCCGTTCGGGGTAACCTC
ACGGCGCCGACAGACCCACAGCAGCCACAGCAGCCCCAACAACAACAGCTGCAGCTGCCGGGCGCGAGCCTGGTC
AGGAAGTCGAACATTGGAGGATCCAGCGTCTCCCAGCGCATCAAAGCGCTGGAGAAGCTGTCCGCCGCCACGGGA
GATGGAGGAGCGGCCAATTCGCGGGAGCGGCCGTCGTCGACCTTCTTCGCCGTCAAGAAGCGGGAACCGTCGAGG
TCCCCATCCGTCATGGAGCGGGCCAACTCGCTCCGGCGAGGTATACCGGACTCGCGTCCACAATCCAAGGATTCC
TCGTCCGAGTCCGGGAGAGTGAGCCGACAGGAACGATCCGGATCGGTGTCAGACCGGCTCTCCATATTCGAGGCG
CCAACGGGCGCCAATGCCTTGAGCCGCCCGCCCAGCAGCTCCAGGCGCGGTCGCCCGGAGTCGGTCTCGGTCACG
GCCAAGATCGTCCGGGATTCGAGCCAGGGCTTGCAGACCGGCCTCGAGCCGCCCAGGGATCCGTCCGAGTACAGC
CGCCTCGAGCTGAAGCAGTCGCCCCTGGTGGTGGACCGTCAGACTGCGATCCCGGAGGTCGTTCCGGCGCCGGCG
GCGAAGCCAGCTGCGGAGCGTCGGTCCGCTTCCGAGGAACGGGCCAAGCCGATCAAATCGCGGCAGTCGTCGCTG
AGCATAGTCAAGGATTTCATCAAAGAGCGCCGTAAGTCGGTCACGTCGAACCAGGGAGACGCTTCGGCCGCGGCC
GCCTCGTCGCGCTCGCCGTCGCGCTCGCCTCCCGTGCAGCAGGGTAGCACCTTCTCCCCCCGCCTATCCATAAGC
AGCCATCGGTCGTCACTCAGCCGGGACCGCGACAGCGTCACGTCGCCGACCGGGGAGAGCTTCGGGGGGGACGAC
GGCAAGTCGGCCAACGGGGACAAGAAGCTGTCCCGAGCCGGGCGATTCATGCGCCGTCTATCTAATCTGTCCGGG
TCGCGCAGCAAGAACTCGCCGACGGGCATCGCGCACGCAGTGGCCGAGGAGGTCCCCGAGCCCGAGATTCCGAGG
CCGGCGACGACCGGGTCGCCGACGGTCGTCTCGTACATGGGCGACGTCAACGTGCAGTTTCCGGACACGCTGCTC
TGGAAGCGCAGGAACCTCAGCCTCGACTCGCAGGGATTCCTCATCCTGAACGCGCTGCCGGCCCAGAGCGGCCGG
CAGGCCCTGGGCATCAAGCGGTACCACCTCAGCGAGTTCCGGCCGCCGTACATACCGGACGTCGAGATCCAGGAG
CTGCCCAACAGCGTGGTGCTGGACTTCATCGAGGGCGCCAGCATCCAGATCGCGTGCGAGGACCGGGCGGGCCAG
GCGAACGTGCTAGGCATTCTCCGCGAGGCCCACGGCACGCGTGGCTCTACATACGGTCTCTGA
Gene >Hirsu2|3220
ATGTCGCTCAACGGCCTGGACGATCCAACGATCGTCGACGCTCACGAGACGGCCACTTCGGAACCGGGAGGATGG
TATGCCACGCTTCTGCTCTCTCTATCGGATGCCTGTGCCGCAATGGATGGCTGACTCGACGTACTCGTCGCGCCT
TCGTCTGTCCGCGTAGGTTTCTGCTCAAGTACTCCAACAGGGACGAGGTCCAACTGTTGAGCCGTGGCAATGGGG
GTATTGTGGAAATGCGCAGCGCTGTGTCCAACTACGATGAGACGAGCCCGCTCTATGGTTTCTTAAAGTATCGCA
GGAGGAACGTCGTAATCAAGTACCTCCCGGAGGACTGCTCCCGGCTGATACAAGGTGGGTTGCAGACAATTGCGT
GACGCGAACCTGTCTCGACGCCGCAACACGCTTCCTCTGCGCCTCACGGCGAGCTTCCGCCTCTCTCGTCGTCTT
TCGGCACAACCGCATCTTGTTTCTGACACGCTGACGCTCCGCCTCTCCTCACAGCTCGCGTAGCCGTGCACTTCA
ATGCCATCTGCGAACGCTTCTCCCCCTACGATGCCATGTTCGAAATCACCACACCGGGCGAGCTCATAGACACCA
AGCTGTCTCTGGCCTGCTCTCTGCACGCCGCCTCCTGCTCGACTTCGTCCTCCAGCAGCTCCTTGCGCAGACGAC
GTCTGATGGAGATCGCCGAAGAGGAGGAGGAAGAGCAGCGTGCCTCCAAGCGCCAGTCCATTGAGGAACCGACAT
ACGATCGACCTCGGTCGCCGGCAGCCTCCTCAGCCGCAGATCCTGTGGCTCTCGATTCCCATCTCGCTGCCTTCC
CGGAGCACAGCAAGTTTTCGGCCTATTCAACCTTAGAACTGCCGACCTTCGTTGGTGCCGACAATCGGCCGACAT
CCTCCGCCAAATCAATGGATGTCGATCCCAACCTCAGCTACGCGTCGTTCCCGTACGGCAAGCCCAAGGTGAAAT
TGGGACCCCGTCCATCGCTCGAAGTGAGCGGCCGGCCGCGGACTGCCGGCAACTTCCGCCCCATTTCGGCCATCC
CGGCCGGCTTTAAGCTCTTCGGCAAGGGCAGCAAGAAGGCCAAGAAGGACCGCAATAGCACTATAGTAGCCTCTC
AGGAAGCACCCGCTAGCGTCACATCAGACCCTTCCGCCATCGCCACGTCCGAAGATGTCCAACCGGCGCGAGGGA
AAGCTGCTTCGCTTCACGCGAGCTCCGGCGTTTCTGCGGATCTCTCCCTGATGCCGCCGACACAGTCGACATCGA
CGAAAAAACCGGCCGTATCTCCCGAAAAAGCGAGGCTGATGAAGGCCATGCAATTGAGACAGAAGAAGAAGATGA
TGGACCTGAGATCACACAGTGACGCACATTCTCTCAACGACCTACCACCAGAGGCCGGCGAGTTGGACCACACGG
CGCACAAGACGGAAATGGGCCCCGAATCCGAGCACAAGGAAGACCACCTTGCACAAGCCGACGACGGAGCTGTAG
CGGCCCCCGCGTCGTCCTCGGCGCACACCGATCAGACATCAGATCTTACACAGACCGATTCGCGACCAGTCAGCC
CTTTGGTGGCCCTGTCTGAGGCGGACCAGTCCACTAAGGCGTCATCACTCTCAGAATCGACTCATGAGACACCAA
GGGCGGAGGACCGGGCACCCGCGCTAGGCAACGGCGCGACACTACGAATCCCGCCGAAAGACAACGCGAACGATG
ATGAGCACGCACCGGCTGCCCATGCCCCTCGATCAGAGACTGCGCCCTTGCGGGTCTCCGAGGGAAAGGCTGACG
AGGGGGCTCCTGAAAGCCCTCGCGAGGCCGCCCCTGCTTCAGAAGCCAGGGCGGCTGGTGCCCGACGGCCGCAAA
ACGAACCCGCCGAAAAATCGGACGCCGAAGCCGCGAACCTTGCCGCCGCGCCGAATCCATCAACCGCTGCCACCG
AGCTACTTTCAGCTCCTCAAGCCATCTCGGATCGGAGCACAAGCTCCCAAAACGAAGGCGAGAAGCACAAGATTA
CCTCACTCCCGATATCAAAGTTCTCCGTCGTCGACATTCCACCGTCGCCCAAGCTCCCTCAGGAAGCGGTACCGA
GCCACGCGGACCCCGAGACGCCAGAAATTCCAGCGCCGACGTCCGCCGGGGACGCGACAACAACAGACGCGAGCG
AGGACCCCGCTTCTCGACAGCAGAACCTTTCCATCTCTCCGACCTCACCGCAAGCCTCTGCAGCTCCTACAACGG
TAATCGCTGCTTCAGTCGCATCGTTCGGGACATCGCAGCCGCCGCCCGTGAGCGTTCAAACCAATTCCTCGGACC
GCGCTCCTCAGCAGATCGCAAGCGAGGCAGACTCGACGGCCGCTCAACGAGGCCAGCCGAAACGAAAGGGACATA
TCGAGCCCATCCGGACCGACCTCGCACAGCACAGTCGCCAGACGTCACACTCTGGGGCCAATTTCTCGGACGACG
AGGAGCTGATGGAAGAGCTGCGGAGTGCGACACTGCAAGAAGCGAAGCCAATGTTGGTGGCCAAGACTCCCGTTT
CAACGACCTTCTCGACCAGTCCCACCAAGGGGAGGGCGGCAGCAAACGCACATGTGGTGCGCACCGTTTCCAACC
CCGTTCGGGGTAACCTCACGGCGCCGACAGACGTGAGTCAATCCTCGGCGAGATCAGCCAGCTCCGGGGCGGCAT
TCTCACATCAGGTCACGCAACAGCCACAGCAGCCACAGCAGCCCCAACAACAACAGCTGCAGCTGCCGGGCGCGA
GCCTGGTCAGGAAGTCGAACATTGGAGGATCCAGCGTCTCCCAGCGCATCAAAGCGCTGGAGAAGCTGTCCGCCG
CCACGGGAGATGGAGGAGCGGCCAATTCGCGGGAGCGGCCGTCGTCGACCTTCTTCGCCGTCAAGAAGCGGGAAC
CGTCGAGGTCCCCATCCGTCATGGAGCGGGCCAACTCGCTCCGGCGAGGTATACCGGACTCGCGTCCACAATCCA
AGGATTCCTCGTCCGAGTCCGGGAGAGTGAGCCGACAGGAACGATCCGGATCGGTGTCAGACCGGCTCTCCATAT
TCGAGGCGCCAACGGGCGCCAATGCCTTGAGCCGCCCGCCCAGCAGCTCCAGGCGCGGTCGCCCGGAGTCGGTCT
CGGTCACGGCCAAGATCGTCCGGGATTCGAGCCAGGGCTTGCAGACCGGCCTCGAGCCGCCCAGGGATCCGTCCG
AGTACAGCCGCCTCGAGCTGAAGCAGTCGCCCCTGGTGGTGGACCGTCAGACTGCGATCCCGGAGGTCGTTCCGG
CGCCGGCGGCGAAGCCAGCTGCGGAGCGTCGGTCCGCTTCCGAGGAACGGGCCAAGCCGATCAAATCGCGGCAGT
CGTCGCTGAGCATAGTCAAGGATTTCATCAAAGAGCGCCGTAAGTCGGTCACGTCGAACCAGGGAGACGCTTCGG
CCGCGGCCGCCTCGTCGCGCTCGCCGTCGCGCTCGCCTCCCGTGCAGCAGGGTAGCACCTTCTCCCCCCGCCTAT
CCATAAGCAGCCATCGGTCGTCACTCAGCCGGGACCGCGACAGCGTCACGTCGCCGACCGGGGAGAGCTTCGGGG
GGGACGACGGCAAGTCGGCCAACGGGGACAAGAAGCTGTCCCGAGCCGGGCGATTCATGCGCCGTCTATCTAATC
TGTCCGGGTCGCGCAGCAAGAACTCGCCGACGGGCATCGCGCACGCAGTGGCCGAGGAGGTCCCCGAGCCCGAGA
TTCCGAGGCCGGCGACGACCGGGTCGCCGACGGTCGTCTCGTACATGGGCGACGTCAACGTGCAGTTTCCGGACA
CGCTGCTCTGGAAGCGCAGGAACCTCAGCCTCGACTCGCAGGGATTCCTCATCCTGAACGCGCTGCCGGCCCAGA
GCGGCCGGCAGGCCCTGGGCATCAAGCGGTACCACCTCAGCGAGTTCCGGCCGCCGTACATACCGGACGTCGAGA
TCCAGGAGCTGCCCAACAGCGTGGTGCTGGACTTCATCGAGGGCGCCAGCATCCAGATCGCGTGCGAGGACCGGG
CGGGCCAGGCGAACGTGCTAGGCAGTGAGTTTTCACCGAGGCTCGGGAAGAGTGTGAAGTCGGCTGACGTTGCGT
GCAGTTCTCCGCGAGGCCCACGGCACGCGTGGCTCTACATACGGTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail