Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3210
Gene name
LocationContig_182:10122..11311
Strand+
Gene length (bp)1189
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 1.8E-53 7 310
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 4.5E-08 3 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I4V0|2NPD_PSEAE Nitronate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1024 PE=1 SV=1 5 322 8.0E-107
sp|Q4L4T4|2NPD_STAHJ Probable nitronate monooxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1 1 228 2.0E-26
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 1 230 2.0E-23
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 7 256 3.0E-22
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 7 256 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I4V0|2NPD_PSEAE Nitronate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1024 PE=1 SV=1 5 322 8.0E-107
sp|Q4L4T4|2NPD_STAHJ Probable nitronate monooxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1 1 228 2.0E-26
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 1 230 2.0E-23
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 7 256 3.0E-22
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 7 256 3.0E-22
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 7 256 3.0E-22
sp|A8Z1H7|2NPD_STAAT Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1 7 256 4.0E-22
sp|A6QFD2|2NPD_STAAE Probable nitronate monooxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1 7 256 4.0E-22
sp|Q5HHG4|2NPD_STAAC Probable nitronate monooxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1 7 256 4.0E-22
sp|Q2FZX9|2NPD_STAA8 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1 7 256 4.0E-22
sp|Q2FIF3|2NPD_STAA3 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1 7 256 4.0E-22
sp|Q6GB05|2NPD_STAAS Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1 7 256 5.0E-22
sp|Q8NXG7|2NPD_STAAW Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MW2) GN=MW0803 PE=3 SV=1 7 256 5.0E-22
sp|Q6GIG7|2NPD_STAAR Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1 7 256 6.0E-22
sp|O05413|2NPD_BACSU Probable nitronate monooxygenase OS=Bacillus subtilis (strain 168) GN=yrpB PE=3 SV=1 4 313 4.0E-20
sp|Q01284|2NPD_NEUCR Nitronate monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ncd-2 PE=1 SV=1 17 326 6.0E-07
sp|O06179|Y1533_MYCTU Putative monooxygenase Rv1533 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1533 PE=1 SV=1 29 326 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0018580 nitronate monooxygenase activity Yes
GO:0003824 catalytic activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3210
MAIVTELTRRLGIRVPVVQGGMMHVGTADLASAVSNAGGLGIITALIFASPAALRAEIRRCRTLTRAPFGVNLTL
LPAMVPPDYGAYTQAVIDEGVRVVETAGNSPGPVIAQLKRAGVTVLHKCTSIRHARSAVKLGVDFLSIDGFECAG
HVGESDITNFILLGRARQALGDVPFIASGGFADGQGLAAALCLGAAGVNMGTRFMCTLEAPIHVAVKEAIVAADE
TDTTLLLRRWRNTTRLFRNRVALEALAVERDSKTGEFAEVAPLVSGKRGKEVFTTGDPEHGVWTAGQVIGLIHDI
PSCDALVKRIEKEAETTLQDRLALVQPASKL*
Coding >Hirsu2|3210
ATGGCCATCGTGACGGAACTGACGCGGCGGCTGGGGATCCGAGTGCCGGTGGTGCAGGGCGGGATGATGCACGTC
GGGACAGCGGACCTGGCGTCGGCGGTGTCGAACGCGGGCGGGCTGGGCATCATCACGGCGCTCATCTTCGCGTCG
CCGGCGGCGCTGCGGGCGGAGATACGGCGGTGCCGGACGCTGACGCGGGCGCCCTTCGGCGTCAACCTGACGCTG
CTGCCGGCCATGGTGCCGCCCGACTACGGGGCGTACACGCAGGCGGTCATCGACGAGGGCGTGCGCGTGGTGGAG
ACGGCCGGCAACTCGCCGGGCCCCGTCATCGCGCAGCTGAAGCGCGCCGGCGTCACGGTGCTGCACAAGTGCACC
TCGATCCGCCACGCCCGCAGCGCCGTCAAGCTCGGCGTCGACTTCCTCAGCATCGACGGCTTCGAGTGCGCCGGC
CACGTGGGCGAGAGCGACATCACCAACTTCATCCTGCTCGGCCGCGCGCGCCAGGCCCTCGGCGACGTGCCCTTC
ATCGCCTCGGGCGGCTTCGCGGATGGCCAGGGCCTGGCGGCGGCGCTGTGCCTGGGCGCCGCCGGCGTCAACATG
GGCACCCGCTTCATGTGCACCCTTGAGGCGCCCATCCACGTCGCGGTCAAGGAGGCCATTGTCGCCGCTGACGAG
ACGGACACGACGCTGCTGTTGCGCCGCTGGCGGAACACGACCCGTCTCTTTCGCAACCGCGTTGCGCTCGAGGCC
CTGGCCGTCGAGCGCGACAGCAAGACGGGCGAGTTTGCCGAGGTCGCGCCCCTTGTCAGCGGCAAGCGTGGCAAG
GAGGTCTTTACCACCGGCGACCCCGAGCACGGCGTATGGACGGCCGGCCAGGTCATCGGCCTCATCCACGACATC
CCCTCCTGCGACGCCCTGGTCAAGCGGATCGAGAAGGAGGCCGAGACGACGTTACAGGACAGGCTGGCGCTCGTC
CAGCCGGCGTCCAAGCTATGA
Transcript >Hirsu2|3210
ATGGCCATCGTGACGGAACTGACGCGGCGGCTGGGGATCCGAGTGCCGGTGGTGCAGGGCGGGATGATGCACGTC
GGGACAGCGGACCTGGCGTCGGCGGTGTCGAACGCGGGCGGGCTGGGCATCATCACGGCGCTCATCTTCGCGTCG
CCGGCGGCGCTGCGGGCGGAGATACGGCGGTGCCGGACGCTGACGCGGGCGCCCTTCGGCGTCAACCTGACGCTG
CTGCCGGCCATGGTGCCGCCCGACTACGGGGCGTACACGCAGGCGGTCATCGACGAGGGCGTGCGCGTGGTGGAG
ACGGCCGGCAACTCGCCGGGCCCCGTCATCGCGCAGCTGAAGCGCGCCGGCGTCACGGTGCTGCACAAGTGCACC
TCGATCCGCCACGCCCGCAGCGCCGTCAAGCTCGGCGTCGACTTCCTCAGCATCGACGGCTTCGAGTGCGCCGGC
CACGTGGGCGAGAGCGACATCACCAACTTCATCCTGCTCGGCCGCGCGCGCCAGGCCCTCGGCGACGTGCCCTTC
ATCGCCTCGGGCGGCTTCGCGGATGGCCAGGGCCTGGCGGCGGCGCTGTGCCTGGGCGCCGCCGGCGTCAACATG
GGCACCCGCTTCATGTGCACCCTTGAGGCGCCCATCCACGTCGCGGTCAAGGAGGCCATTGTCGCCGCTGACGAG
ACGGACACGACGCTGCTGTTGCGCCGCTGGCGGAACACGACCCGTCTCTTTCGCAACCGCGTTGCGCTCGAGGCC
CTGGCCGTCGAGCGCGACAGCAAGACGGGCGAGTTTGCCGAGGTCGCGCCCCTTGTCAGCGGCAAGCGTGGCAAG
GAGGTCTTTACCACCGGCGACCCCGAGCACGGCGTATGGACGGCCGGCCAGGTCATCGGCCTCATCCACGACATC
CCCTCCTGCGACGCCCTGGTCAAGCGGATCGAGAAGGAGGCCGAGACGACGTTACAGGACAGGCTGGCGCTCGTC
CAGCCGGCGTCCAAGCTATGA
Gene >Hirsu2|3210
ATGGCCATCGTGACGGAACTGACGCGGCGGCTGGGGATCCGAGGTACGCAACGTCCCCCCCTCCCCTTCGGGCCC
CTTCGGGCTCAACAAGAGGTGCATGTCTCTGACGGAGGGACCGGTTCCGGGGAGCACAGTGCCGGTGGTGCAGGG
CGGGATGATGCACGTCGGGACAGCGGACCTGGCGTCGGCGGTGTCGAACGCGGGCGGGCTGGGCATCATCACGGC
GCTCATCTTCGCGTCGCCGGCGGCGCTGCGGGCGGAGATACGGCGGTGCCGGACGCTGACGCGGGCGCCCTTCGG
CGTCAACCTGACGCTGCTGCCGGCCATGGTGCCGCCCGACTACGGGGCGTACACGCAGGCGGTCATCGACGAGGG
CGTGCGCGTGGTGGAGACGGCCGGCAACTCGCCGGGCCCCGTCATCGCGCAGCTGAAGCGCGCCGGCGTCACGGT
GCTGCACAAGTGCACCTCGATCCGCCACGCCCGCAGCGCCGTCAAGCTCGGCGTCGACTTCCTCAGCATCGACGG
CTTCGAGTGCGCCGGCCACGTGGGCGAGAGCGACATCACCAACTTCATCCTGCTCGGCCGCGCGCGCCAGGCCCT
CGGCGACGTGCCCTTCATCGCCTCGGGCGGCTTCGCGGATGGCCAGGGCCTGGCGGCGGCGCTGTGCCTGGGCGC
CGCCGGCGTCAACATGGGCACCCGCTTCATGTGCACCCTTGAGGCGCCCATCCACGTCGCGGTCAAGGAGGCCAT
TGTCGCCGCTGACGAGACGGACACGACGCTGCTGTTGCGCCGCTGGCGGAACACGACCCGTCTCTTTCGCAACCG
CGTTGCGCTCGAGGCCCTGGCCGTCGAGCGCGACAGCAAGACGGGCGAGTTTGCCGAGGTCGCGCCCCTTGTCAG
CGGCAAGCGTGGCAAGGAGGTCTTTACCACCGGCGACCCCGAGCACGGCGTCAGTTTTTCTCTCCTCTCTCTCCC
TCTCTCTGTCTCTCTCCAAAATACACACTATGCACACACTCATACCGACCGCGCTCTCGCTGACCCCCCTCTCCA
GGTATGGACGGCCGGCCAGGTCATCGGCCTCATCCACGACATCCCCTCCTGCGACGCCCTGGTCAAGCGGATCGA
GAAGGAGGCCGAGACGACGTTACAGGACAGGCTGGCGCTCGTCCAGCCGGCGTCCAAGCTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail