Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3209
Gene name
LocationContig_182:5694..9119
Strand+
Gene length (bp)3425
Transcript length (bp)2814
Coding sequence length (bp)2814
Protein length (aa) 938

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.0E-03 36 57
PF00096 zf-C2H2 Zinc finger, C2H2 type 8.4E-03 63 88
PF04082 Fungal_trans Fungal specific transcription factor domain 9.6E-08 391 624

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 22 88 1.0E-13
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 30 119 1.0E-12
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 14 98 1.0E-11
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 15 98 3.0E-11
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 2 114 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 22 88 1.0E-13
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 30 119 1.0E-12
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 14 98 1.0E-11
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 15 98 3.0E-11
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 2 114 3.0E-11
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 14 98 3.0E-11
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 23 113 5.0E-11
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 26 90 1.0E-10
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 15 138 1.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 26 90 1.0E-10
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 28 96 2.0E-10
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 15 138 3.0E-10
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 25 98 3.0E-10
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 15 98 5.0E-10
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 28 135 5.0E-10
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 15 98 5.0E-10
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 15 98 6.0E-10
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 37 98 8.0E-10
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 17 86 9.0E-10
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 26 98 9.0E-10
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 26 98 9.0E-10
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 33 83 1.0E-09
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 28 88 1.0E-09
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 33 88 1.0E-09
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 26 98 2.0E-09
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 33 99 2.0E-09
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 26 90 3.0E-09
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 26 90 3.0E-09
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 26 90 3.0E-09
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 26 90 3.0E-09
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 33 90 3.0E-09
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 29 133 3.0E-09
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 26 90 4.0E-09
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 26 90 5.0E-09
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 26 90 1.0E-08
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 29 83 1.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 30 98 2.0E-08
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 30 98 2.0E-08
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 30 98 2.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 33 115 3.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 33 98 3.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 33 98 3.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 33 115 3.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 33 115 3.0E-08
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 28 118 3.0E-08
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 30 104 3.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 33 98 4.0E-08
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 19 91 4.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 16 85 5.0E-08
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 16 85 5.0E-08
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 30 95 5.0E-08
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 30 86 5.0E-08
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 26 95 5.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 14 85 6.0E-08
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 33 109 6.0E-08
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 31 139 6.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 14 85 1.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 33 98 1.0E-07
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 37 85 1.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 33 98 1.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 14 85 2.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 14 85 2.0E-07
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 30 116 2.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 33 117 2.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 37 85 2.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 37 86 2.0E-07
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 40 83 2.0E-07
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 40 88 2.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 33 90 2.0E-07
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 32 86 3.0E-07
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 37 139 3.0E-07
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 37 85 3.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 37 102 3.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 37 85 3.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 33 89 3.0E-07
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 33 98 3.0E-07
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 14 85 4.0E-07
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 37 85 4.0E-07
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 37 86 4.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 37 85 4.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 30 88 4.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 16 83 4.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 33 89 4.0E-07
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 15 86 4.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 33 89 4.0E-07
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 33 86 4.0E-07
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 37 83 4.0E-07
sp|P53243|YG2A_YEAST Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR067C PE=3 SV=2 33 88 4.0E-07
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 28 86 5.0E-07
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 26 85 5.0E-07
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 37 83 5.0E-07
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 40 107 5.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 30 95 5.0E-07
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 31 85 5.0E-07
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 40 85 6.0E-07
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 40 83 6.0E-07
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 28 88 7.0E-07
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 33 86 7.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 33 137 7.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 33 89 7.0E-07
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 30 89 8.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 40 83 8.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 40 83 8.0E-07
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 37 89 8.0E-07
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 40 85 8.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 24 85 9.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 24 85 9.0E-07
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 40 85 9.0E-07
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 40 85 9.0E-07
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 40 85 1.0E-06
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 15 86 1.0E-06
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 33 94 1.0E-06
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 37 85 1.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 27 85 1.0E-06
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 15 86 1.0E-06
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 33 94 1.0E-06
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 33 103 1.0E-06
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 15 86 1.0E-06
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 15 86 1.0E-06
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 15 86 1.0E-06
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 37 83 1.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 33 91 1.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 33 125 1.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 33 125 1.0E-06
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 21 86 1.0E-06
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 38 85 1.0E-06
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 38 85 1.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 33 115 1.0E-06
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 33 86 1.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 33 86 2.0E-06
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 33 94 2.0E-06
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 33 94 2.0E-06
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 33 94 2.0E-06
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 39 85 2.0E-06
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 16 86 2.0E-06
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 33 85 2.0E-06
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 39 85 2.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 33 86 2.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 33 85 2.0E-06
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 33 107 2.0E-06
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 37 83 2.0E-06
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 36 142 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 33 125 2.0E-06
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 37 86 2.0E-06
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 19 88 2.0E-06
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 33 86 2.0E-06
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 16 83 2.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 33 125 2.0E-06
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 10 83 2.0E-06
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 37 85 3.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 10 83 3.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 40 104 3.0E-06
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 31 129 3.0E-06
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 37 108 3.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 33 86 3.0E-06
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 16 83 3.0E-06
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 37 108 3.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 33 86 4.0E-06
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 40 83 4.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 37 88 4.0E-06
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 33 87 4.0E-06
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 37 83 4.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 9 86 4.0E-06
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 37 108 4.0E-06
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 37 91 4.0E-06
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 37 83 4.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 33 88 5.0E-06
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 10 83 5.0E-06
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 10 83 5.0E-06
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 33 98 5.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 33 95 5.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 33 117 5.0E-06
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 33 86 5.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 33 94 6.0E-06
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 37 108 6.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 26 86 6.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 33 86 7.0E-06
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 18 86 7.0E-06
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 37 85 7.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 33 140 7.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 33 86 7.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 31 85 7.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 33 91 8.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 9 91 8.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 33 86 8.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 33 86 8.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 33 86 8.0E-06
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 29 83 8.0E-06
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 30 108 8.0E-06
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 40 85 9.0E-06
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 30 139 9.0E-06
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 30 139 9.0E-06
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 20 85 1.0E-05
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 37 85 1.0E-05
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 29 83 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3209
MLPVHHHLEASPPRPPAVVAATMAGQSRDQKPKTLPCKYCNKRFRRVEHVQRHERTHTKEKPFSCGWDRCGKTFG
RRDLLVRHEKLVHLNDGSKEGSRPRKSASSAAASLKPTLTNDNVKANSAPVHQAAVHPPPPPPRPALPPHQHQHQ
HHQHHHHQHPHPHQQLRHQQQQQQQRQQPHFHHVPINTNTASAHIPQDPRAASRSAAPCNLDVLSDAALATEISP
MQQMVSDLDGPHHDHVSAKGFGEPMGAYVERPRDDQQPPLPPGFPPQPPQPLYDDYHVLLDDFAASPHLLPPQFE
TDQQQLGAWSRQPTRPSPQFPSRFASLAPDGRDAGEALYRPHDDLSRAPSFRISTLDHGLIKSRIEEYSAVLPSD
FVFPSRHTLTRFLEGYITGFHDHLPFLHLPTLAPAELAPELLLAILAVGAQYRFESNRGYALWYAAKAVATEQVR
RRHSSEVHALLPTAAAYSPHSTRPSPSTSYRHSFASAQSERPTTQDTHREPYSPNTPQARLETIQAALLLFAVGL
WGAKTILQDALTLQSTLAMLIREEGLSVETSQAVLTDWESWVRLEGANRTKLIAYCFFNLCSVAYDMPPLLMTSE
LNMYLPLRSRLWRAESAWHWQELRHATPAAELTVHEAVARLFGRTNHGLPAHLSALGHYVLIHALIQHVYLLKQT
SFAAGSRHDAHRALRAEDVEEVAHALRVWQTSSEQRRQLRAAESGHHAGAEPAGGGPLTFNATALVRLVYMRLYA
DLAPRRALETRDSMLVASAVSATAPLARSPKLHRAVFQAVHALSMLVKAGVNYVARAKSTEWSIQHSLCNFECAL
LLAKWLLALSAIGPSDPPASPEERSVLGMVRRMLDETEFAVPIDPSLSGGQTEMATSDDGAKLRQLASAVVRLWA
ETFKGTHIFDLVKVMGASLDGYADLVDKPPEGGSAGV*
Coding >Hirsu2|3209
ATGCTCCCCGTCCACCATCATCTCGAGGCTTCGCCGCCTCGTCCGCCCGCCGTTGTCGCCGCCACCATGGCTGGC
CAGAGCCGCGATCAGAAGCCCAAGACGCTGCCGTGCAAGTATTGCAACAAGCGCTTCAGACGTGTTGAGCATGTT
CAGAGGCACGAGAGGACGCACACGAAGGAGAAACCCTTCTCCTGCGGCTGGGACCGCTGTGGGAAGACGTTCGGG
CGCCGTGATCTCCTCGTCAGGCACGAGAAGCTAGTTCATCTGAATGACGGCAGCAAGGAAGGCAGTCGGCCCAGG
AAGTCGGCCTCTTCCGCCGCCGCCTCGCTCAAGCCAACCTTGACCAACGACAACGTCAAGGCCAATTCAGCGCCT
GTCCACCAGGCCGCTGTCCATCCGCCGCCCCCTCCGCCGCGGCCGGCTCTGCCACCGCACCAGCACCAGCACCAG
CACCATCAACACCATCACCACCAGCATCCGCACCCGCACCAGCAGCTGCGGCACCAGCAGCAACAACAGCAGCAA
AGGCAACAACCGCACTTCCACCATGTGCCCATCAATACCAACACCGCGTCGGCACACATCCCCCAGGACCCCCGT
GCCGCGTCCAGATCCGCTGCTCCCTGCAACCTTGACGTCCTTTCGGATGCCGCCCTGGCCACCGAGATCAGCCCC
ATGCAGCAGATGGTGAGTGACTTGGACGGGCCGCATCATGATCATGTTTCCGCGAAGGGCTTCGGGGAGCCCATG
GGCGCCTACGTCGAGAGGCCTCGCGACGACCAGCAACCTCCTCTCCCGCCCGGATTCCCCCCGCAACCGCCGCAG
CCCCTGTACGACGACTACCACGTCTTGCTCGACGACTTCGCCGCTTCGCCCCATCTTCTGCCGCCGCAGTTTGAG
ACGGACCAGCAGCAGCTCGGCGCCTGGTCCCGGCAACCAACGAGGCCGTCGCCCCAGTTCCCCTCGCGTTTCGCC
TCCCTGGCTCCGGACGGCCGCGATGCCGGGGAGGCCCTGTACCGGCCGCACGACGACCTGTCCCGAGCCCCCTCT
TTCCGAATCTCCACGCTCGATCACGGCCTCATCAAGAGTCGAATCGAGGAGTACTCGGCGGTCCTGCCAAGCGAC
TTCGTCTTCCCCTCTCGCCATACCCTCACCCGCTTTCTCGAAGGCTACATCACCGGCTTCCACGACCACCTCCCC
TTTCTGCACCTACCAACGCTCGCCCCGGCCGAGCTGGCGCCGGAGCTGCTGCTCGCCATCCTGGCCGTCGGCGCA
CAGTACCGTTTCGAGAGCAACCGCGGATACGCCCTCTGGTACGCGGCCAAGGCCGTCGCCACGGAGCAGGTCCGG
AGACGGCACAGCTCCGAAGTGCACGCCCTGCTGCCGACGGCTGCGGCCTACAGCCCGCACTCGACAAGGCCGTCG
CCCAGCACTAGCTATCGGCATTCCTTCGCCTCAGCGCAGTCGGAAAGGCCGACGACGCAAGATACACACCGCGAG
CCGTACTCTCCCAACACGCCACAAGCGCGACTGGAAACGATCCAGGCTGCGCTGCTCCTCTTCGCCGTCGGGCTC
TGGGGCGCCAAAACGATACTCCAAGACGCGCTGACGCTGCAGAGCACGCTGGCCATGCTGATTCGCGAGGAGGGC
CTGAGCGTGGAGACGAGCCAGGCGGTCCTGACCGACTGGGAGTCGTGGGTGAGGCTAGAAGGCGCCAACAGGACC
AAGCTCATCGCCTACTGCTTCTTCAACCTCTGCAGCGTCGCCTACGACATGCCGCCGCTGCTCATGACGTCGGAG
CTGAACATGTACCTGCCCCTACGCTCCCGCCTGTGGCGCGCCGAGTCGGCGTGGCATTGGCAGGAGCTGCGTCAC
GCGACGCCGGCAGCCGAGCTGACGGTGCACGAGGCCGTCGCCCGGCTGTTTGGCCGGACGAACCACGGGCTCCCG
GCTCACCTGTCGGCCCTGGGCCACTACGTCCTGATCCACGCCCTGATCCAGCACGTGTACCTGCTGAAGCAGACG
TCGTTCGCGGCGGGCTCTCGGCACGACGCCCACCGAGCGCTCCGGGCGGAGGACGTGGAGGAGGTGGCGCACGCG
TTGCGGGTGTGGCAGACGAGCTCGGAGCAGCGGCGGCAGCTGAGGGCGGCCGAGTCGGGCCACCACGCGGGCGCG
GAGCCGGCGGGGGGCGGGCCGCTGACGTTCAACGCGACGGCGCTGGTGCGGCTGGTGTACATGCGGCTGTACGCG
GATCTGGCGCCCCGGCGGGCGCTGGAGACGCGTGACTCGATGCTGGTGGCGTCGGCGGTGAGCGCGACGGCGCCG
CTGGCGCGGAGCCCCAAGCTGCACCGAGCCGTGTTCCAGGCGGTGCACGCGCTGTCGATGCTGGTCAAGGCCGGG
GTCAACTACGTGGCGAGGGCCAAGTCGACGGAGTGGAGCATCCAGCATTCACTATGCAACTTCGAGTGCGCGCTC
CTGCTGGCCAAGTGGCTCCTGGCGCTATCGGCCATCGGGCCGTCGGACCCGCCGGCGTCTCCCGAGGAGCGGAGC
GTGCTGGGGATGGTGCGCCGGATGCTGGACGAGACGGAGTTTGCGGTGCCGATCGACCCGTCGCTGTCGGGGGGC
CAGACGGAGATGGCGACGAGCGACGACGGGGCCAAGCTGCGGCAGTTGGCCAGCGCCGTGGTCCGGCTCTGGGCG
GAAACGTTCAAGGGGACGCACATCTTCGATCTGGTCAAGGTCATGGGCGCCAGTCTGGACGGGTACGCAGACCTA
GTGGACAAGCCGCCGGAAGGGGGCTCGGCGGGGGTTTGA
Transcript >Hirsu2|3209
ATGCTCCCCGTCCACCATCATCTCGAGGCTTCGCCGCCTCGTCCGCCCGCCGTTGTCGCCGCCACCATGGCTGGC
CAGAGCCGCGATCAGAAGCCCAAGACGCTGCCGTGCAAGTATTGCAACAAGCGCTTCAGACGTGTTGAGCATGTT
CAGAGGCACGAGAGGACGCACACGAAGGAGAAACCCTTCTCCTGCGGCTGGGACCGCTGTGGGAAGACGTTCGGG
CGCCGTGATCTCCTCGTCAGGCACGAGAAGCTAGTTCATCTGAATGACGGCAGCAAGGAAGGCAGTCGGCCCAGG
AAGTCGGCCTCTTCCGCCGCCGCCTCGCTCAAGCCAACCTTGACCAACGACAACGTCAAGGCCAATTCAGCGCCT
GTCCACCAGGCCGCTGTCCATCCGCCGCCCCCTCCGCCGCGGCCGGCTCTGCCACCGCACCAGCACCAGCACCAG
CACCATCAACACCATCACCACCAGCATCCGCACCCGCACCAGCAGCTGCGGCACCAGCAGCAACAACAGCAGCAA
AGGCAACAACCGCACTTCCACCATGTGCCCATCAATACCAACACCGCGTCGGCACACATCCCCCAGGACCCCCGT
GCCGCGTCCAGATCCGCTGCTCCCTGCAACCTTGACGTCCTTTCGGATGCCGCCCTGGCCACCGAGATCAGCCCC
ATGCAGCAGATGGTGAGTGACTTGGACGGGCCGCATCATGATCATGTTTCCGCGAAGGGCTTCGGGGAGCCCATG
GGCGCCTACGTCGAGAGGCCTCGCGACGACCAGCAACCTCCTCTCCCGCCCGGATTCCCCCCGCAACCGCCGCAG
CCCCTGTACGACGACTACCACGTCTTGCTCGACGACTTCGCCGCTTCGCCCCATCTTCTGCCGCCGCAGTTTGAG
ACGGACCAGCAGCAGCTCGGCGCCTGGTCCCGGCAACCAACGAGGCCGTCGCCCCAGTTCCCCTCGCGTTTCGCC
TCCCTGGCTCCGGACGGCCGCGATGCCGGGGAGGCCCTGTACCGGCCGCACGACGACCTGTCCCGAGCCCCCTCT
TTCCGAATCTCCACGCTCGATCACGGCCTCATCAAGAGTCGAATCGAGGAGTACTCGGCGGTCCTGCCAAGCGAC
TTCGTCTTCCCCTCTCGCCATACCCTCACCCGCTTTCTCGAAGGCTACATCACCGGCTTCCACGACCACCTCCCC
TTTCTGCACCTACCAACGCTCGCCCCGGCCGAGCTGGCGCCGGAGCTGCTGCTCGCCATCCTGGCCGTCGGCGCA
CAGTACCGTTTCGAGAGCAACCGCGGATACGCCCTCTGGTACGCGGCCAAGGCCGTCGCCACGGAGCAGGTCCGG
AGACGGCACAGCTCCGAAGTGCACGCCCTGCTGCCGACGGCTGCGGCCTACAGCCCGCACTCGACAAGGCCGTCG
CCCAGCACTAGCTATCGGCATTCCTTCGCCTCAGCGCAGTCGGAAAGGCCGACGACGCAAGATACACACCGCGAG
CCGTACTCTCCCAACACGCCACAAGCGCGACTGGAAACGATCCAGGCTGCGCTGCTCCTCTTCGCCGTCGGGCTC
TGGGGCGCCAAAACGATACTCCAAGACGCGCTGACGCTGCAGAGCACGCTGGCCATGCTGATTCGCGAGGAGGGC
CTGAGCGTGGAGACGAGCCAGGCGGTCCTGACCGACTGGGAGTCGTGGGTGAGGCTAGAAGGCGCCAACAGGACC
AAGCTCATCGCCTACTGCTTCTTCAACCTCTGCAGCGTCGCCTACGACATGCCGCCGCTGCTCATGACGTCGGAG
CTGAACATGTACCTGCCCCTACGCTCCCGCCTGTGGCGCGCCGAGTCGGCGTGGCATTGGCAGGAGCTGCGTCAC
GCGACGCCGGCAGCCGAGCTGACGGTGCACGAGGCCGTCGCCCGGCTGTTTGGCCGGACGAACCACGGGCTCCCG
GCTCACCTGTCGGCCCTGGGCCACTACGTCCTGATCCACGCCCTGATCCAGCACGTGTACCTGCTGAAGCAGACG
TCGTTCGCGGCGGGCTCTCGGCACGACGCCCACCGAGCGCTCCGGGCGGAGGACGTGGAGGAGGTGGCGCACGCG
TTGCGGGTGTGGCAGACGAGCTCGGAGCAGCGGCGGCAGCTGAGGGCGGCCGAGTCGGGCCACCACGCGGGCGCG
GAGCCGGCGGGGGGCGGGCCGCTGACGTTCAACGCGACGGCGCTGGTGCGGCTGGTGTACATGCGGCTGTACGCG
GATCTGGCGCCCCGGCGGGCGCTGGAGACGCGTGACTCGATGCTGGTGGCGTCGGCGGTGAGCGCGACGGCGCCG
CTGGCGCGGAGCCCCAAGCTGCACCGAGCCGTGTTCCAGGCGGTGCACGCGCTGTCGATGCTGGTCAAGGCCGGG
GTCAACTACGTGGCGAGGGCCAAGTCGACGGAGTGGAGCATCCAGCATTCACTATGCAACTTCGAGTGCGCGCTC
CTGCTGGCCAAGTGGCTCCTGGCGCTATCGGCCATCGGGCCGTCGGACCCGCCGGCGTCTCCCGAGGAGCGGAGC
GTGCTGGGGATGGTGCGCCGGATGCTGGACGAGACGGAGTTTGCGGTGCCGATCGACCCGTCGCTGTCGGGGGGC
CAGACGGAGATGGCGACGAGCGACGACGGGGCCAAGCTGCGGCAGTTGGCCAGCGCCGTGGTCCGGCTCTGGGCG
GAAACGTTCAAGGGGACGCACATCTTCGATCTGGTCAAGGTCATGGGCGCCAGTCTGGACGGGTACGCAGACCTA
GTGGACAAGCCGCCGGAAGGGGGCTCGGCGGGGGTTTGA
Gene >Hirsu2|3209
ATGCTCCCCGTCCACCATCATCTCGAGGCTTCGCCGCCTCGTCCGCCCGCCGTTGTCGCCGCCACCATGGCTGGC
CAGAGCCGCGATCAGAAGCCCAAGACGCTGCCGTGCAAGTATTGCAACAAGCGCTTCAGGTCAGTCCCCCTCGTC
CCCGTCCCCGGCTCGCCAGTCAGCTTACACGGAGCCCCCCTGCAGACGTGTTGAGCATGTTCAGAGGCACGAGAG
GACGCACACGAAGGAGAAACCCTTCTCCTGCGGCTGGGACCGCTGTGGGAAGACGTTCGGGCGCCGGTGAGTCTC
TGCTACGGCCTGCAGCCCGCCATCCCACCACTCGCAGATGCTCCTCCACCCCCCTTTTTCTCCCCTCCCCGTTCC
GCCCTGTCACTCCTCGACCACCTCTACAATCTCATTCTTCCATTCCCCATTCGCCTTCTCCTTCGACTCCTCTCG
CTTCTCCCACTCCTCCATCTCCTTCTCGACTTACACGCATCCAACGTTCCACAGCCAGGCACTGCATCCAGGGCT
CATCTTTCATTTGCACACACCTCGCATTTCCCCATTCCCGACAGCGAGGCCTTTGTTTGCGCCGCCGCCGCCGCC
GCCGCCGCCGCCTCTTACCCCTTAGATCTCAAGCTCCTCTCGGCCAAGATACTTATATGGACATCAGTGATCTCC
TCGTCAGGCACGAGAAGCTAGTTCATCTGAATGACGGCAGCAAGGAAGGCAGTCGGCCCAGGAAGTCGGCCTCTT
CCGCCGCCGCCTCGCTCAAGCCAACCTTGACCAACGACAACGTCAAGGCCAATTCAGCGCCTGTCCACCAGGCCG
CTGTCCATCCGCCGCCCCCTCCGCCGCGGCCGGCTCTGCCACCGCACCAGCACCAGCACCAGCACCATCAACACC
ATCACCACCAGCATCCGCACCCGCACCAGCAGCTGCGGCACCAGCAGCAACAACAGCAGCAAAGGCAACAACCGC
ACTTCCACCATGTGCCCATCAATACCAACACCGCGTCGGCACACATCCCCCAGGACCCCCGTGCCGCGTCCAGAT
CCGCTGCTCCCTGCAACCTTGACGTCCTTTCGGATGCCGCCCTGGCCACCGAGATCAGCCCCATGCAGCAGATGG
TGAGTGACTTGGACGGGCCGCATCATGATCATGTTTCCGCGAAGGGCTTCGGGGAGCCCATGGGCGCCTACGTCG
AGAGGCCTCGCGACGACCAGCAACCTCCTCTCCCGCCCGGATTCCCCCCGCAACCGCCGCAGCCCCTGTACGACG
ACTACCACGTCTTGCTCGACGACTTCGCCGCTTCGCCCCATCTTCTGCCGCCGCAGTTTGAGACGGACCAGCAGC
AGCTCGGCGCCTGGTCCCGGCAACCAACGAGGCCGTCGCCCCAGTTCCCCTCGCGTTTCGCCTCCCTGGCTCCGG
ACGGCCGCGATGCCGGGGAGGCCCTGTACCGGCCGCACGACGACCTGTCCCGAGCCCCCTCTTTCCGAATCTCCA
CGCTCGATCACGGCCTCATCAAGAGTCGAATCGAGGAGTACTCGGCGGTCCTGCCAAGCGACTTCGTCTTCCCCT
CTCGCCATACCCTCACCCGCTTTCTCGAAGGCTACATCACCGGCTTCCACGACCACCTCCCCTTTCTGCACCTAC
CAACGCTCGCCCCGGCCGAGCTGGCGCCGGAGCTGCTGCTCGCCATCCTGGCCGTCGGCGCACAGTACCGTTTCG
AGAGCAACCGCGGATACGCCCTCTGGTACGCGGCCAAGGCCGTCGCCACGGAGCAGGTCCGGAGACGGCACAGCT
CCGAAGTGCACGCCCTGCTGCCGACGGCTGCGGCCTACAGCCCGCACTCGACAAGGCCGTCGCCCAGCACTAGCT
ATCGGCATTCCTTCGCCTCAGCGCAGTCGGAAAGGCCGACGACGCAAGATACACACCGCGAGCCGTAGTAAGTGC
CCCCTCCCCCCTCTCCCTTTTCTTCGGCCGCGCGGCAAGGACAGGCGCCGACCGCTGACGTTTTCCACTCGCGCC
CGCGCACACAGCTCTCCCAACACGCCACAAGCGCGACTGGAAACGATCCAGGCTGCGCTGCTCCTCTTCGCCGTC
GGGCTCTGGGGCGCCAAAACGATACTCCAAGACGCGCTGACGCTGCAGAGCACGCTGGCCATGCTGATTCGCGAG
GAGGGCCTGAGCGTGGAGACGAGCCAGGCGGTCCTGACCGACTGGGAGTCGTGGGTGAGGCTAGAAGGCGCCAAC
AGGACCAAGCTCATCGCCTACTGCTTCTTCAACCTCTGCAGCGTCGCCTACGACATGCCGCCGCTGCTCATGACG
TCGGAGCTGAACATGTACCTGCCCCTACGCTCCCGCCTGTGGCGCGCCGAGTCGGCGTGGCATTGGCAGGAGCTG
CGTCACGCGACGCCGGCAGCCGAGCTGACGGTGCACGAGGCCGTCGCCCGGCTGTTTGGCCGGACGAACCACGGG
CTCCCGGCTCACCTGTCGGCCCTGGGCCACTACGTCCTGATCCACGCCCTGATCCAGCACGTGTACCTGCTGAAG
CAGACGTCGTTCGCGGCGGGCTCTCGGCACGACGCCCACCGAGCGCTCCGGGCGGAGGACGTGGAGGAGGTGGCG
CACGCGTTGCGGGTGTGGCAGACGAGCTCGGAGCAGCGGCGGCAGCTGAGGGCGGCCGAGTCGGGCCACCACGCG
GGCGCGGAGCCGGCGGGGGGCGGGCCGCTGACGTTCAACGCGACGGCGCTGGTGCGGCTGGTGTACATGCGGCTG
TACGCGGATCTGGCGCCCCGGCGGGCGCTGGAGACGCGTGACTCGATGCTGGTGGCGTCGGCGGTGAGCGCGACG
GCGCCGCTGGCGCGGAGCCCCAAGCTGCACCGAGCCGTGTTCCAGGCGGTGCACGCGCTGTCGATGCTGGTCAAG
GCCGGGGTCAACTACGTGGCGAGGGCCAAGTCGACGGAGTGGAGCATCCAGCATTCACGCAAGTGGCTCCCGACA
GGCAGAGGTCCCCCCCCCCTCTGGCCGCGGGGGAACGAGGAGCGCTGACCGTGAGGACGATAGTATGCAACTTCG
AGTGCGCGCTCCTGCTGGCCAAGTGGCTCCTGGCGCTATCGGCCATCGGGCCGTCGGACCCGCCGGCGTCTCCCG
AGGAGCGGAGCGTGCTGGGGATGGTGCGCCGGATGCTGGACGAGACGGAGTTTGCGGTGCCGATCGACCCGTCGC
TGTCGGGGGGCCAGACGGAGATGGCGACGAGCGACGACGGGGCCAAGCTGCGGCAGTTGGCCAGCGCCGTGGTCC
GGCTCTGGGCGGAAACGTTCAAGGGGACGCACATCTTCGATCTGGTCAAGGTCATGGGCGCCAGTCTGGACGGGT
ACGCAGACCTAGTGGACAAGCCGCCGGAAGGGGGCTCGGCGGGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail