Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3206
Gene name
LocationContig_1819:3495..4713
Strand-
Gene length (bp)1218
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13422 DUF4110 Domain of unknown function (DUF4110) 1.6E-31 256 346

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 3 170 8.0E-17
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 9 211 2.0E-14
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 9 172 1.0E-13
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 9 172 7.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3206
MTWHKGRGILFGGVHDVEQGEDGMDSEFFNQLFAWNIERNRFMPLGLRKPRQQQQRRGGPEQRVGRRGRAQANEE
ELLRQLAALETGASLDDADGIELEKKGAEEARDDDEQPAREMPVATEPPHARFNAQLAVQADVLYIYGGTFEKGD
VEVTFDDLHAIDLSKLDGCKEIFNRPVEDWIESEDEDDEDEDEDDEEDEDEDDEDDEEEPGGDGPEQRLHTASKR
KKKADSISDTASEAASAAPSEEDETETTATSVDDGLPHPRPFESRREFFVRTSAEWQEVLMTSLRWKGTQPEALT
IKELKSKAFELSEEKWWDCREEITALEEEQEAAGIQEVVSLAERGDAAAAGAARRR*
Coding >Hirsu2|3206
ATGACGTGGCACAAGGGCCGCGGCATCCTCTTCGGCGGCGTCCACGACGTCGAGCAGGGCGAGGACGGCATGGAC
AGCGAGTTCTTCAACCAGCTGTTCGCGTGGAACATTGAGCGCAACCGCTTCATGCCCCTGGGGCTCCGCAAGCCC
CGCCAGCAGCAGCAGAGGAGGGGCGGGCCGGAGCAGCGCGTCGGCCGCCGCGGCCGGGCCCAGGCCAACGAGGAG
GAGCTCCTGCGGCAGCTCGCCGCCCTCGAGACGGGCGCCTCCCTGGACGACGCCGACGGCATCGAGCTGGAGAAG
AAGGGGGCGGAAGAGGCGCGGGACGACGACGAGCAGCCGGCGAGGGAGATGCCGGTCGCGACGGAACCGCCGCAC
GCGAGGTTCAACGCGCAGCTGGCCGTCCAGGCCGACGTGCTGTACATCTACGGCGGCACCTTTGAGAAGGGGGAC
GTGGAGGTTACGTTTGACGACCTGCACGCCATCGACCTGAGCAAGCTCGACGGCTGCAAAGAAATCTTTAACCGG
CCCGTCGAGGACTGGATCGAGTCTGAGGACGAGGACGACGAGGACGAGGACGAGGACGACGAGGAAGACGAGGAC
GAAGACGACGAGGACGACGAGGAAGAGCCCGGCGGTGACGGGCCGGAGCAGCGGCTGCACACGGCCAGCAAGCGG
AAGAAGAAGGCGGACTCCATCTCGGACACGGCCTCGGAGGCGGCTTCGGCGGCCCCGTCGGAAGAGGACGAGACG
GAGACGACGGCGACATCGGTGGACGACGGCCTCCCTCACCCACGACCGTTCGAGTCTCGGCGCGAGTTCTTCGTG
CGGACGTCGGCGGAATGGCAGGAGGTGCTGATGACGAGCCTGCGGTGGAAGGGCACGCAGCCAGAGGCGCTGACG
ATCAAGGAGCTCAAGTCGAAGGCGTTCGAGCTGAGCGAGGAGAAGTGGTGGGACTGCCGGGAGGAGATCACGGCG
CTGGAGGAGGAGCAGGAGGCGGCGGGCATCCAGGAGGTGGTGAGCCTGGCGGAGAGGGGCGACGCCGCGGCGGCG
GGCGCGGCGCGGCGGCGCTGA
Transcript >Hirsu2|3206
ATGACGTGGCACAAGGGCCGCGGCATCCTCTTCGGCGGCGTCCACGACGTCGAGCAGGGCGAGGACGGCATGGAC
AGCGAGTTCTTCAACCAGCTGTTCGCGTGGAACATTGAGCGCAACCGCTTCATGCCCCTGGGGCTCCGCAAGCCC
CGCCAGCAGCAGCAGAGGAGGGGCGGGCCGGAGCAGCGCGTCGGCCGCCGCGGCCGGGCCCAGGCCAACGAGGAG
GAGCTCCTGCGGCAGCTCGCCGCCCTCGAGACGGGCGCCTCCCTGGACGACGCCGACGGCATCGAGCTGGAGAAG
AAGGGGGCGGAAGAGGCGCGGGACGACGACGAGCAGCCGGCGAGGGAGATGCCGGTCGCGACGGAACCGCCGCAC
GCGAGGTTCAACGCGCAGCTGGCCGTCCAGGCCGACGTGCTGTACATCTACGGCGGCACCTTTGAGAAGGGGGAC
GTGGAGGTTACGTTTGACGACCTGCACGCCATCGACCTGAGCAAGCTCGACGGCTGCAAAGAAATCTTTAACCGG
CCCGTCGAGGACTGGATCGAGTCTGAGGACGAGGACGACGAGGACGAGGACGAGGACGACGAGGAAGACGAGGAC
GAAGACGACGAGGACGACGAGGAAGAGCCCGGCGGTGACGGGCCGGAGCAGCGGCTGCACACGGCCAGCAAGCGG
AAGAAGAAGGCGGACTCCATCTCGGACACGGCCTCGGAGGCGGCTTCGGCGGCCCCGTCGGAAGAGGACGAGACG
GAGACGACGGCGACATCGGTGGACGACGGCCTCCCTCACCCACGACCGTTCGAGTCTCGGCGCGAGTTCTTCGTG
CGGACGTCGGCGGAATGGCAGGAGGTGCTGATGACGAGCCTGCGGTGGAAGGGCACGCAGCCAGAGGCGCTGACG
ATCAAGGAGCTCAAGTCGAAGGCGTTCGAGCTGAGCGAGGAGAAGTGGTGGGACTGCCGGGAGGAGATCACGGCG
CTGGAGGAGGAGCAGGAGGCGGCGGGCATCCAGGAGGTGGTGAGCCTGGCGGAGAGGGGCGACGCCGCGGCGGCG
GGCGCGGCGCGGCGGCGCTGA
Gene >Hirsu2|3206
ATGACGTGGCACAAGGGCCGCGGCATCCTCTTCGGCGGCGTCCACGACGTCGAGCAGGGCGAGGACGGCATGGAC
AGCGAGTTCTTCAACCAGCTGTTCGCGTGGAACATTGAGCGCAACCGCTTCATGCCCCTGGGGCTCCGCAAGCCC
CGCCAGCAGCAGCAGAGGAGGGGCGGGCCGGAGCAGCGCGTCGGCCGCCGCGGCCGGGCCCAGGCCAACGAGGAG
GAGCTCCTGCGGCAGCTCGCCGCCCTCGAGACGGGCGCCTCCCTGGACGACGCCGACGGCATCGAGCTGGAGAAG
AAGGGGGCGGAAGAGGCGCGGGACGACGACGAGCAGCCGGCGAGGGAGATGCCGGTCGCGACGGAACCGCCGCAC
GCGAGGTTCAACGCGCAGCTGGCCGTCCAGGCCGACGTGCTGTACATCTACGGCGGCACCTTTGAGAAGGGGGAC
GTGGAGGTTACGTTTGACGACCTGCACGCCATCGACCTGAGCAAGCTCGACGGCTGCAAAGAAATCTTTAACCGG
CCCGTCGAGGACTGGATCGTGAGTTTCGGTCCTGGCTACGCTCGAGAAGCTATCGCTCTAACAGGGCTTCATAGG
AGTCTGAGGACGAGGACGACGAGGACGAGGACGAGGACGACGAGGAAGACGAGGACGAAGACGACGAGGACGACG
AGGAAGAGCCCGGCGGTGACGGGCCGGAGCAGCGGCTGCACACGGCCAGCAAGCGGAAGAAGAAGGCGGACTCCA
TCTCGGACACGGCCTCGGAGGCGGCTTCGGCGGCCCCGTCGGAAGAGGACGAGACGGAGACGACGGCGACATCGG
TGGACGACGGCCTCCCTCACCCACGAGTAAGCTGCCCTCCCCCGCCGACCCGGCCCGATTTCCGCGAGGAGACAA
GGGGAAGGGGGTTCGTCGCCGGTACTGACCCGTTGCGCGCAGCCGTTCGAGTCTCGGCGCGAGTTCTTCGTGCGG
ACGTCGGCGGAATGGCAGGAGGTGCTGATGACGAGCCTGCGGTGGAAGGGCACGCAGCCAGAGGCGCTGACGATC
AAGGAGCTCAAGTCGAAGGCGTTCGAGCTGAGCGAGGAGAAGTGGTGGGACTGCCGGGAGGAGATCACGGCGCTG
GAGGAGGAGCAGGAGGCGGCGGGCATCCAGGAGGTGGTGAGCCTGGCGGAGAGGGGCGACGCCGCGGCGGCGGGC
GCGGCGCGGCGGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail