Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3205
Gene name
LocationContig_1819:1759..2695
Strand+
Gene length (bp)936
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01470 Peptidase_C15 Pyroglutamyl peptidase 4.1E-06 88 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ESW8|PGPI_MOUSE Pyroglutamyl-peptidase 1 OS=Mus musculus GN=Pgpep1 PE=1 SV=1 7 210 5.0E-19
sp|Q9NXJ5|PGPI_HUMAN Pyroglutamyl-peptidase 1 OS=Homo sapiens GN=PGPEP1 PE=1 SV=1 7 210 1.0E-18
sp|Q76IC5|PGPI_RAT Pyroglutamyl-peptidase 1 OS=Rattus norvegicus GN=Pgpep1 PE=1 SV=1 7 210 3.0E-18
sp|B9J587|PCP_BACCQ Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain Q1) GN=pcp PE=3 SV=1 12 210 1.0E-12
sp|B6YUJ5|PCP_THEON Pyrrolidone-carboxylate peptidase OS=Thermococcus onnurineus (strain NA1) GN=pcp PE=3 SV=1 11 210 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ESW8|PGPI_MOUSE Pyroglutamyl-peptidase 1 OS=Mus musculus GN=Pgpep1 PE=1 SV=1 7 210 5.0E-19
sp|Q9NXJ5|PGPI_HUMAN Pyroglutamyl-peptidase 1 OS=Homo sapiens GN=PGPEP1 PE=1 SV=1 7 210 1.0E-18
sp|Q76IC5|PGPI_RAT Pyroglutamyl-peptidase 1 OS=Rattus norvegicus GN=Pgpep1 PE=1 SV=1 7 210 3.0E-18
sp|B9J587|PCP_BACCQ Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain Q1) GN=pcp PE=3 SV=1 12 210 1.0E-12
sp|B6YUJ5|PCP_THEON Pyrrolidone-carboxylate peptidase OS=Thermococcus onnurineus (strain NA1) GN=pcp PE=3 SV=1 11 210 6.0E-12
sp|B7IMH6|PCP_BACC2 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain G9842) GN=pcp PE=3 SV=1 12 210 7.0E-12
sp|C1F026|PCP_BACC3 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain 03BB102) GN=pcp PE=3 SV=1 12 210 1.0E-11
sp|Q735N6|PCP_BACC1 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pcp PE=3 SV=1 12 210 1.0E-11
sp|Q639M5|PCP_BACCZ Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain ZK / E33L) GN=pcp PE=3 SV=1 12 232 2.0E-11
sp|B7HVU3|PCP_BACC7 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain AH187) GN=pcp PE=3 SV=1 12 210 2.0E-11
sp|Q81NT5|PCP_BACAN Pyrrolidone-carboxylate peptidase OS=Bacillus anthracis GN=pcp PE=1 SV=1 12 210 2.0E-11
sp|C3LDV2|PCP_BACAC Pyrrolidone-carboxylate peptidase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pcp PE=3 SV=1 12 210 2.0E-11
sp|C3P0R7|PCP_BACAA Pyrrolidone-carboxylate peptidase OS=Bacillus anthracis (strain A0248) GN=pcp PE=3 SV=1 12 210 2.0E-11
sp|Q6HH08|PCP_BACHK Pyrrolidone-carboxylate peptidase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pcp PE=3 SV=1 12 210 6.0E-11
sp|Q5JEL5|PCP_THEKO Pyrrolidone-carboxylate peptidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pcp PE=3 SV=1 11 229 7.0E-11
sp|B7JDC3|PCP_BACC0 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain AH820) GN=pcp PE=3 SV=1 12 210 1.0E-10
sp|Q9UYQ9|PCP_PYRAB Pyrrolidone-carboxylate peptidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pcp PE=3 SV=1 11 210 1.0E-10
sp|A0RFP3|PCP_BACAH Pyrrolidone-carboxylate peptidase OS=Bacillus thuringiensis (strain Al Hakam) GN=pcp PE=3 SV=1 12 210 2.0E-10
sp|A9VKA7|PCP_BACWK Pyrrolidone-carboxylate peptidase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pcp PE=3 SV=1 12 210 3.0E-10
sp|B7H8H3|PCP_BACC4 Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain B4264) GN=pcp PE=3 SV=1 12 210 2.0E-09
sp|Q81BT3|PCP_BACCR Pyrrolidone-carboxylate peptidase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pcp PE=3 SV=1 12 210 4.0E-09
sp|Q8XXE9|PCP1_RALSO Pyrrolidone-carboxylate peptidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=pcp1 PE=3 SV=1 12 210 7.0E-09
sp|O73944|PCP_PYRFU Pyrrolidone-carboxylate peptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pcp PE=1 SV=1 11 210 2.0E-08
sp|C0ZCX0|PCP_BREBN Pyrrolidone-carboxylate peptidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pcp PE=3 SV=1 12 210 1.0E-07
sp|A8MJA9|PCP_ALKOO Pyrrolidone-carboxylate peptidase OS=Alkaliphilus oremlandii (strain OhILAs) GN=pcp PE=3 SV=1 11 210 6.0E-07
sp|P28618|PCP_BACSU Pyrrolidone-carboxylate peptidase OS=Bacillus subtilis (strain 168) GN=pcp PE=1 SV=1 13 210 1.0E-06
sp|A7GQB6|PCP_BACCN Pyrrolidone-carboxylate peptidase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pcp PE=3 SV=1 12 210 2.0E-06
sp|A6NFU8|PGPIL_HUMAN Pyroglutamyl-peptidase 1-like protein OS=Homo sapiens GN=PGPEP1L PE=2 SV=4 54 210 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3205
MGSQTRDQRELTVLVTGFGPFRDQYPVNPAWEIAKGLPSELPPSAAVRGKEAGGATTTPPVRILVHPEPVRVSYK
AVRALVPDFWETYQGCEVDVVVHIGMAGPRPFYHIERRAHRTGYGSLDVDGETLEDEDEARRGPGWIWHGLPDEI
ETDLDLDDVLDRWQGHSSKDMDLRISEDAGRYLCDFIYYSSLSTLLKQQRPRKAVFFHVPSDASDRHVAQGRELA
VNLIRAIAESEAARASGPEA*
Coding >Hirsu2|3205
ATGGGGTCGCAGACCAGAGACCAGCGGGAGCTGACGGTGCTCGTCACCGGCTTCGGCCCGTTCCGTGATCAGTAT
CCCGTCAACCCGGCGTGGGAGATCGCAAAGGGCCTGCCGTCCGAGCTTCCGCCCTCGGCCGCCGTCCGGGGCAAG
GAGGCGGGCGGCGCGACGACGACGCCGCCGGTCCGCATCCTCGTCCACCCGGAGCCCGTCCGCGTCAGCTACAAG
GCCGTGCGGGCGCTGGTGCCCGACTTCTGGGAGACGTACCAGGGCTGCGAGGTCGACGTCGTCGTCCACATCGGC
ATGGCCGGCCCGCGGCCCTTCTACCACATCGAGCGCAGGGCCCACCGCACCGGCTACGGCTCGCTCGACGTCGAC
GGCGAGACGCTCGAGGACGAGGACGAGGCCCGTCGCGGGCCCGGCTGGATCTGGCACGGCCTGCCGGACGAGATC
GAGACGGACCTCGACCTGGACGACGTCCTCGACCGGTGGCAGGGACACAGCTCGAAGGACATGGACCTGCGCATA
TCCGAGGACGCCGGCCGGTACCTGTGCGACTTCATCTACTACTCGAGCCTGTCGACGCTGCTCAAGCAGCAGCGC
CCGCGCAAGGCCGTCTTCTTCCACGTGCCCTCCGACGCCTCGGACCGGCACGTCGCCCAGGGCCGCGAGCTCGCC
GTCAACCTGATCCGCGCCATCGCCGAGAGCGAGGCGGCCCGGGCGTCGGGCCCCGAGGCCTAG
Transcript >Hirsu2|3205
ATGGGGTCGCAGACCAGAGACCAGCGGGAGCTGACGGTGCTCGTCACCGGCTTCGGCCCGTTCCGTGATCAGTAT
CCCGTCAACCCGGCGTGGGAGATCGCAAAGGGCCTGCCGTCCGAGCTTCCGCCCTCGGCCGCCGTCCGGGGCAAG
GAGGCGGGCGGCGCGACGACGACGCCGCCGGTCCGCATCCTCGTCCACCCGGAGCCCGTCCGCGTCAGCTACAAG
GCCGTGCGGGCGCTGGTGCCCGACTTCTGGGAGACGTACCAGGGCTGCGAGGTCGACGTCGTCGTCCACATCGGC
ATGGCCGGCCCGCGGCCCTTCTACCACATCGAGCGCAGGGCCCACCGCACCGGCTACGGCTCGCTCGACGTCGAC
GGCGAGACGCTCGAGGACGAGGACGAGGCCCGTCGCGGGCCCGGCTGGATCTGGCACGGCCTGCCGGACGAGATC
GAGACGGACCTCGACCTGGACGACGTCCTCGACCGGTGGCAGGGACACAGCTCGAAGGACATGGACCTGCGCATA
TCCGAGGACGCCGGCCGGTACCTGTGCGACTTCATCTACTACTCGAGCCTGTCGACGCTGCTCAAGCAGCAGCGC
CCGCGCAAGGCCGTCTTCTTCCACGTGCCCTCCGACGCCTCGGACCGGCACGTCGCCCAGGGCCGCGAGCTCGCC
GTCAACCTGATCCGCGCCATCGCCGAGAGCGAGGCGGCCCGGGCGTCGGGCCCCGAGGCCTAG
Gene >Hirsu2|3205
ATGGGGTCGCAGACCAGAGACCAGCGGGAGCTGACGGTGCTCGTCACCGGCTTCGGCGCAAGTAACGCTCCGTCC
ACGCCCCCTCGCGGCCGGTGGTGCTGACTCGGCCCGCCTCCTCCCCGTCCCGGCCCCTCCCGCCTCCGCCCTTTC
CCCATGGACACAGCCGTTCCGTGATCAGTATCCCGTCAACCCGGCGTGGGAGATCGCAAAGGGCCTGCCGTCCGA
GCTTCCGCCCTCGGCCGCCGTCCGGGGCAAGGAGGCGGGCGGCGCGACGACGACGCCGCCGGTCCGCATCCTCGT
CCACCCGGAGCCCGTCCGCGTCAGCTACAAGGCCGTGCGGGCGCTGGTGCCCGACTTCTGGGAGACGTACCAGGG
CTGCGAGGTCGACGTCGTCGTCCACATCGGCATGGCCGGCCCGCGGCCCTTCTACCACATCGAGCGCAGGGCCCA
CCGCACCGGCTACGGCTCGCTCGACGTCGACGGCGAGACGCTCGAGGACGAGGACGAGGCCCGTCGCGGGCCCGG
CTGGATCTGGCACGGCCTGCCGGACGAGATCGAGACGGACCTCGACCTGGACGACGTCCTCGACCGGTGGCAGGG
ACACAGCTCGGTGCGTTTTTTTTTTCCCAGACATAAAAAAAAAAAAAACTTGGCTGTGGTCACGTCGTCGTCGTC
GTCGTCGCCGCGCTGACCGCGGCACAGAAGGACATGGACCTGCGCATATCCGAGGACGCCGGCCGGTACCTGTGC
GACTTCATCTACTACTCGAGCCTGTCGACGCTGCTCAAGCAGCAGCGCCCGCGCAAGGCCGTCTTCTTCCACGTG
CCCTCCGACGCCTCGGACCGGCACGTCGCCCAGGGCCGCGAGCTCGCCGTCAACCTGATCCGCGCCATCGCCGAG
AGCGAGGCGGCCCGGGCGTCGGGCCCCGAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail