Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|320
Gene name
LocationContig_1060:4684..6828
Strand-
Gene length (bp)2144
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07713 DUF1604 Protein of unknown function (DUF1604) 3.9E-40 38 124
PF01585 G-patch G-patch domain 1.2E-04 150 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BRR8|GPTC1_HUMAN G patch domain-containing protein 1 OS=Homo sapiens GN=GPATCH1 PE=1 SV=1 11 612 3.0E-51
sp|Q24K12|GPTC1_BOVIN G patch domain-containing protein 1 OS=Bos taurus GN=GPATCH1 PE=2 SV=1 10 612 3.0E-49
sp|Q9DBM1|GPTC1_MOUSE G patch domain-containing protein 1 OS=Mus musculus GN=Gpatch1 PE=2 SV=1 10 612 1.0E-46
sp|Q9HE07|YK96_SCHPO Uncharacterized protein C20H4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.06c PE=4 SV=1 2 612 2.0E-42
sp|Q9VUA0|GPTC1_DROME G patch domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG8833 PE=2 SV=1 21 613 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BRR8|GPTC1_HUMAN G patch domain-containing protein 1 OS=Homo sapiens GN=GPATCH1 PE=1 SV=1 11 612 3.0E-51
sp|Q24K12|GPTC1_BOVIN G patch domain-containing protein 1 OS=Bos taurus GN=GPATCH1 PE=2 SV=1 10 612 3.0E-49
sp|Q9DBM1|GPTC1_MOUSE G patch domain-containing protein 1 OS=Mus musculus GN=Gpatch1 PE=2 SV=1 10 612 1.0E-46
sp|Q9HE07|YK96_SCHPO Uncharacterized protein C20H4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.06c PE=4 SV=1 2 612 2.0E-42
sp|Q9VUA0|GPTC1_DROME G patch domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG8833 PE=2 SV=1 21 613 1.0E-35
sp|Q67VW6|TGHH_ORYSJ G patch domain-containing protein TGH homolog OS=Oryza sativa subsp. japonica GN=Os06g0489200 PE=2 SV=1 13 288 6.0E-31
sp|B8B2G4|TGHH_ORYSI G patch domain-containing protein TGH homolog OS=Oryza sativa subsp. indica GN=OsI_23032 PE=3 SV=1 13 288 1.0E-30
sp|Q21827|GPTC1_CAEEL G patch domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=R07E5.1 PE=1 SV=1 14 329 3.0E-27
sp|Q8GXN9|TGH_ARATH G patch domain-containing protein TGH OS=Arabidopsis thaliana GN=TGH PE=2 SV=1 18 285 6.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0003676 nucleic acid binding Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006396 RNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016071 mRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|320
MSHKRSRNTFEADNHAPFAVFGTPLPDEAEARDDGSFVPIWKQEVRDEKGRKRLHGAFTGGWSAGYFNTVGSKEG
WTPSTFVSSRSNRRKDGPASNPRRAEDYMDEEDLADAAEAQTLQTSQAFAGLGSTTQARAQPGLVMGLFRAEGNT
MGLQLLRRMGWKDGQGIGPKVRRGARLGLDQASAVTGGETYLFAPENAPMVRFVRKTDRKGLGHQGEARLRTLGQ
DRNVDDDDDSGNESAGGGAKLGRDSHLAFLTKAKGKPQPARGAFGVGVLNDTGSDDEDPYDIGPKIKYNRSVGGL
KRKKNKKEASAVVNPALTNAPRFVPKTARAGNSLRRCHDGRLPLDGFVLAKVTEDFAALLSQYAPVPIPAGWKSS
KGRPATAEASKYVSTADAAKASNHDPRSRAAMLGEKALPGKSVFDYLSASARDKLVTATGKQDLPPARGEVPTRL
AVSDEERQRWLLDRAPKLDRDTAVAALSRGSLGPYADDESKRSRYRRYLEHQSNPDMPPPSKTTKMTDDDFLREL
NEFYNCARIFKPMTGFMASRFTTSKVGLSLSGGLAATDTEPLSKPAPKPADPAEEAARLGMFGPMTRSIEDFYPT
RLLCKRFNVKPPLHSRPDNVAEDGPSRSAAPSQMPESRPVPTNSQAPALEAKGAAAQEPDNARVDPDRNEALEGA
TANAGVLRAIFGDSDSE*
Coding >Hirsu2|320
ATGTCCCACAAGCGATCCCGCAACACCTTCGAAGCGGACAACCATGCTCCCTTTGCCGTCTTTGGAACCCCACTC
CCCGACGAGGCCGAGGCTCGCGACGATGGATCCTTCGTGCCCATTTGGAAGCAGGAGGTGAGGGACGAGAAAGGG
AGGAAACGGCTACACGGCGCCTTCACGGGAGGTTGGAGCGCAGGATATTTCAACACCGTCGGATCCAAAGAAGGC
TGGACGCCGTCGACCTTTGTGTCCAGCCGATCAAACCGCCGCAAAGATGGCCCTGCATCGAATCCGCGGCGCGCG
GAGGACTACATGGACGAGGAAGATCTTGCCGATGCGGCCGAGGCGCAGACGTTGCAGACGTCCCAAGCCTTTGCC
GGGCTCGGCTCGACCACGCAGGCGCGGGCCCAGCCGGGGCTGGTCATGGGCCTCTTCAGGGCAGAAGGGAATACG
ATGGGCCTGCAGCTCCTGCGTCGCATGGGCTGGAAAGATGGTCAGGGGATCGGCCCCAAGGTTCGACGAGGCGCA
CGACTAGGTTTGGATCAGGCATCCGCCGTCACTGGCGGAGAAACTTATCTATTCGCCCCCGAAAATGCACCGATG
GTACGATTCGTTCGCAAGACCGACCGCAAGGGGCTGGGCCACCAAGGCGAGGCTCGGCTCCGGACCCTCGGCCAG
GACAGAAACGTGGATGACGACGACGATAGTGGCAACGAATCCGCGGGGGGAGGGGCCAAGCTCGGCCGAGATTCC
CACTTGGCATTCCTCACCAAGGCCAAGGGAAAGCCACAACCAGCACGAGGTGCTTTTGGGGTGGGAGTTCTCAAC
GACACTGGCTCAGACGACGAGGACCCCTACGACATTGGCCCAAAGATCAAGTATAACCGAAGCGTCGGTGGACTG
AAGAGGAAGAAGAACAAAAAAGAAGCTTCGGCCGTCGTCAACCCAGCCCTCACGAATGCACCCAGGTTTGTCCCC
AAGACCGCCCGGGCTGGAAACAGCCTGCGTCGATGTCACGACGGGCGACTACCTCTCGACGGCTTCGTCTTAGCC
AAAGTCACCGAGGATTTTGCCGCCCTCTTATCACAATACGCGCCCGTGCCGATCCCAGCCGGATGGAAGTCATCC
AAGGGCCGGCCCGCCACGGCGGAGGCGTCGAAGTATGTGTCGACGGCGGACGCGGCCAAGGCTTCCAACCACGAC
CCCAGGTCCAGAGCAGCCATGCTGGGCGAAAAGGCTCTGCCGGGAAAGTCCGTCTTCGATTACCTGTCGGCGTCT
GCGCGGGATAAACTTGTCACGGCCACGGGCAAGCAGGACCTCCCTCCAGCGAGAGGCGAGGTGCCGACACGCCTG
GCCGTGTCGGACGAGGAGCGGCAGAGGTGGCTGTTGGACCGGGCCCCGAAGCTCGACCGCGATACGGCTGTCGCA
GCCTTGTCCAGAGGCTCCCTAGGGCCGTACGCAGACGACGAGTCAAAGCGATCGCGATACCGACGCTATCTCGAA
CATCAATCGAACCCCGATATGCCGCCTCCGAGCAAGACGACGAAGATGACAGACGACGACTTTTTACGGGAATTG
AACGAATTTTACAACTGCGCGCGCATTTTCAAGCCGATGACTGGATTCATGGCCTCACGCTTTACGACCTCCAAG
GTCGGCCTGAGCCTGTCGGGCGGCCTTGCAGCGACCGATACAGAGCCGCTGTCCAAGCCGGCACCAAAGCCGGCG
GACCCTGCGGAAGAGGCGGCGCGGCTGGGAATGTTTGGTCCCATGACGCGATCGATCGAGGATTTTTATCCCACC
CGCCTGCTCTGCAAGCGGTTCAACGTCAAGCCACCATTGCACTCGCGCCCAGATAACGTGGCCGAGGACGGCCCT
TCGAGAAGTGCGGCACCTTCTCAAATGCCGGAGTCCCGGCCAGTACCGACCAACAGCCAGGCTCCTGCCCTAGAA
GCCAAGGGCGCGGCGGCACAGGAGCCAGACAACGCAAGGGTAGACCCGGACCGGAACGAGGCTTTGGAGGGGGCT
ACGGCCAATGCCGGTGTGCTGCGGGCCATATTTGGCGACAGCGACAGCGAGTGA
Transcript >Hirsu2|320
ATGTCCCACAAGCGATCCCGCAACACCTTCGAAGCGGACAACCATGCTCCCTTTGCCGTCTTTGGAACCCCACTC
CCCGACGAGGCCGAGGCTCGCGACGATGGATCCTTCGTGCCCATTTGGAAGCAGGAGGTGAGGGACGAGAAAGGG
AGGAAACGGCTACACGGCGCCTTCACGGGAGGTTGGAGCGCAGGATATTTCAACACCGTCGGATCCAAAGAAGGC
TGGACGCCGTCGACCTTTGTGTCCAGCCGATCAAACCGCCGCAAAGATGGCCCTGCATCGAATCCGCGGCGCGCG
GAGGACTACATGGACGAGGAAGATCTTGCCGATGCGGCCGAGGCGCAGACGTTGCAGACGTCCCAAGCCTTTGCC
GGGCTCGGCTCGACCACGCAGGCGCGGGCCCAGCCGGGGCTGGTCATGGGCCTCTTCAGGGCAGAAGGGAATACG
ATGGGCCTGCAGCTCCTGCGTCGCATGGGCTGGAAAGATGGTCAGGGGATCGGCCCCAAGGTTCGACGAGGCGCA
CGACTAGGTTTGGATCAGGCATCCGCCGTCACTGGCGGAGAAACTTATCTATTCGCCCCCGAAAATGCACCGATG
GTACGATTCGTTCGCAAGACCGACCGCAAGGGGCTGGGCCACCAAGGCGAGGCTCGGCTCCGGACCCTCGGCCAG
GACAGAAACGTGGATGACGACGACGATAGTGGCAACGAATCCGCGGGGGGAGGGGCCAAGCTCGGCCGAGATTCC
CACTTGGCATTCCTCACCAAGGCCAAGGGAAAGCCACAACCAGCACGAGGTGCTTTTGGGGTGGGAGTTCTCAAC
GACACTGGCTCAGACGACGAGGACCCCTACGACATTGGCCCAAAGATCAAGTATAACCGAAGCGTCGGTGGACTG
AAGAGGAAGAAGAACAAAAAAGAAGCTTCGGCCGTCGTCAACCCAGCCCTCACGAATGCACCCAGGTTTGTCCCC
AAGACCGCCCGGGCTGGAAACAGCCTGCGTCGATGTCACGACGGGCGACTACCTCTCGACGGCTTCGTCTTAGCC
AAAGTCACCGAGGATTTTGCCGCCCTCTTATCACAATACGCGCCCGTGCCGATCCCAGCCGGATGGAAGTCATCC
AAGGGCCGGCCCGCCACGGCGGAGGCGTCGAAGTATGTGTCGACGGCGGACGCGGCCAAGGCTTCCAACCACGAC
CCCAGGTCCAGAGCAGCCATGCTGGGCGAAAAGGCTCTGCCGGGAAAGTCCGTCTTCGATTACCTGTCGGCGTCT
GCGCGGGATAAACTTGTCACGGCCACGGGCAAGCAGGACCTCCCTCCAGCGAGAGGCGAGGTGCCGACACGCCTG
GCCGTGTCGGACGAGGAGCGGCAGAGGTGGCTGTTGGACCGGGCCCCGAAGCTCGACCGCGATACGGCTGTCGCA
GCCTTGTCCAGAGGCTCCCTAGGGCCGTACGCAGACGACGAGTCAAAGCGATCGCGATACCGACGCTATCTCGAA
CATCAATCGAACCCCGATATGCCGCCTCCGAGCAAGACGACGAAGATGACAGACGACGACTTTTTACGGGAATTG
AACGAATTTTACAACTGCGCGCGCATTTTCAAGCCGATGACTGGATTCATGGCCTCACGCTTTACGACCTCCAAG
GTCGGCCTGAGCCTGTCGGGCGGCCTTGCAGCGACCGATACAGAGCCGCTGTCCAAGCCGGCACCAAAGCCGGCG
GACCCTGCGGAAGAGGCGGCGCGGCTGGGAATGTTTGGTCCCATGACGCGATCGATCGAGGATTTTTATCCCACC
CGCCTGCTCTGCAAGCGGTTCAACGTCAAGCCACCATTGCACTCGCGCCCAGATAACGTGGCCGAGGACGGCCCT
TCGAGAAGTGCGGCACCTTCTCAAATGCCGGAGTCCCGGCCAGTACCGACCAACAGCCAGGCTCCTGCCCTAGAA
GCCAAGGGCGCGGCGGCACAGGAGCCAGACAACGCAAGGGTAGACCCGGACCGGAACGAGGCTTTGGAGGGGGCT
ACGGCCAATGCCGGTGTGCTGCGGGCCATATTTGGCGACAGCGACAGCGAGTGA
Gene >Hirsu2|320
ATGTCCCACAAGCGATCCCGCAACACCTTCGAAGCGGACAACCATGCTCCCTTTGCCGTCTTTGGAACCCCACTC
CCCGACGAGGCCGAGGCTCGCGACGATGGATCCTTCGTGCCCATTTGGAAGCAGGAGGTGAGGGACGAGAAAGGG
AGGAAACGGCTACACGGCGCCTTCACGGGAGGTTGGAGCGCAGGGTGAGTAAGGCTCTGGCCCGGGCAAGGGCTC
GCGTCTCCCACCTTACCAACGCTTGCGTCGGCAGATATTTCAACACCGTCGGATCCAAAGAAGGCTGGACGCCGT
CGACCTTTGTGTCCAGCCGATCAAACCGCCGCAAAGATGGCCCTGCATCGAATCCGCGGCGCGCGGAGGACTACA
TGGACGAGGAAGATCTTGCCGATGCGGCCGAGGCGCAGACGTTGCAGACGTCCCAAGCCTTTGCCGGGCTCGGCT
CGACCACGCAGGCGCGGGCCCAGCCGGGGCTGGTCATGGGCCTCTTCAGGGCAGAAGGGAATACGATGGGCCTGC
AGCTCCTGCGTCGCATGGGCTGGAAAGATGGTCAGGGGATCGGCCCCAAGGTTCGACGAGGCGCACGACTAGGTT
TGGATCAGGCATCCGCCGTCACTGGCGGAGAAACTTATCTATTCGCCCCCGAAAATGCACCGATGGTACGATTCG
TTCGCAAGACCGACCGCAAGGGGCTGGGCCACCAAGGCGAGGCTCGGCTCCGGACCCTCGGCCAGGACAGAAACG
TGGATGACGACGACGATAGTGGCAACGAATCCGCGGGGGGAGGGGCCAAGCTCGGCCGAGATTCCCACTTGGCAT
TCCTCACCAAGGCCAAGGGAAAGCCACAACCAGCACGAGGTGCTTTTGGGGTGGGAGTTCTCAACGACACTGGCT
CAGACGACGAGGACCCCTACGACATTGGCCCAAAGATCAAGTATAACCGAAGCGTCGGTGGACTGAAGAGGAAGA
AGAACAAAAAAGAAGCTTCGGCCGTCGTCAACCCAGCCCTCACGAATGCACCCAGGTTTGTCCCCAAGACCGCCC
GGGCTGGAAACAGCCTGCGTCGATGTCACGACGGGCGACTACCTCTCGACGGCTTCGTCTTAGCCAAAGTCACCG
AGGATTTTGCCGCCCTCTTATCACAATACGCGCCCGTGCCGATCCCAGCCGGATGGAAGTCATCCAAGGGCCGGC
CCGCCACGGCGGAGGCGTCGAAGTATGTGTCGACGGCGGACGCGGCCAAGGCTTCCAACCACGACCCCAGGTCCA
GAGCAGCCATGCTGGGCGAAAAGGCTCTGCCGGGAAAGTCCGTCTTCGATTACCTGTCGGCGTCTGCGCGGGATA
AACTTGTCACGGCCACGGGCAAGCAGGACCTCCCTCCAGCGAGAGGCGAGGTGCCGACACGCCTGGCCGTGTCGG
ACGAGGAGCGGCAGAGGTGGCTGTTGGACCGGGCCCCGAAGCTCGACCGCGATACGGCTGTCGCAGCCTTGTCCA
GAGGCTCCCTAGGGCCGTACGCAGACGACGAGTCAAAGCGATCGCGATACCGACGCTATCTCGAACATCAATCGA
ACCCCGATATGCCGCCTCCGAGCAAGACGACGAAGATGACAGACGACGACTTTTTACGGGAATTGAACGAATTTT
ACAACTGCGCGCGCATTTTCAAGCCGATGACTGGATTCATGGCCTCACGCTTTACGACCTCCAAGGTCGGCCTGA
GCCTGTCGGGCGGCCTTGCAGCGACCGATACAGAGCCGCTGTCCAAGCCGGCACCAAAGCCGGCGGACCCTGCGG
AAGAGGCGGCGCGGCTGGGAATGTTTGGTCCCATGACGCGATCGATCGAGGATTTTTATCCCACCCGCCTGCTCT
GCAAGCGGTTCAACGTCAAGCCACCATTGCACTCGCGCCCAGATAACGTGGCCGAGGACGGCCCTTCGAGAAGTG
CGGCACCTTCTCAAATGCCGGAGTCCCGGCCAGTACCGACCAACAGCCAGGCTCCTGCCCTAGAAGCCAAGGGCG
CGGCGGCACAGGAGCCAGACAACGCAAGGGTAGACCCGGACCGGAACGAGGCTTTGGAGGGGGCTACGGCCAATG
CCGGTGTGCTGCGGGCCATATTTGGCGACAGCGACAGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail