Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3187
Gene name
LocationContig_1811:3111..4645
Strand-
Gene length (bp)1534
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 7.9E-70 37 310

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 2 309 2.0E-51
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 2 309 3.0E-51
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 32 321 1.0E-42
sp|P59723|HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio GN=hif1an PE=2 SV=2 176 305 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.559 0.793 0.052 0.0049 0.2032 0.0896 0.1522 0.0927 0.1336 0.0407

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2334
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7568
Ophiocordyceps australis map64 (Brazil) OphauB2|3747
Ophiocordyceps camponoti-floridani Ophcf2|04749
Ophiocordyceps camponoti-rufipedis Ophun1|10
Ophiocordyceps kimflemingae Ophio5|4143
Ophiocordyceps subramaniannii Hirsu2|3187 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3187
MATLSTMDPALRDLICTYNELNSPFVEELDSEPSPLEFMRFVARSAPFVVRGGASSWKATRKWNSAYLKSSLEGQ
TINVAVTPTGYADSPTFSPQHDVTVFAKPCEESQPFEQFLSYITRQETDSTFPPDSEVRYAQTQNDNLRDEYLAL
FPDVQKDIPFARIALQKSPDALNIWIGNSRSVTAIHKDNFENIYVQVVGRKHFLLLPPLCQPCMNEKLLPPATFT
REGQGLSLRLDEPCEPVPFATWDPDEAQADATSLSHLARPLRVTLEPGDMLYLPALWYHKVSQSCLEGGEGFNVA
INYWYDMEFRGTLFPLSVFLRSLGTDQDAME*
Coding >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTC
TTTGCGAAACCTTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCG
ACCTTCCCTCCAGACTCGGAGGTGAGGTATGCGCAGACCCAAAACGATAACCTTCGGGACGAGTACCTGGCACTA
TTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCTGATGCCTTAAATATTTGG
ATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTATGTCCAAGTTGTTGGCAGG
AAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTCCCTCCCGCCACCTTCACT
CGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTCGCAACTTGGGATCCGGAC
GAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACTCTCGAGCCTGGCGACATG
CTGTATTTGCCGGCCCTGTGGTACCACAAAGTCTCACAATCTTGCCTGGAAGGCGGTGAGGGCTTTAATGTTGCA
ATTAATTACTGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACGCAGCCTCGGCACA
GACCAGGACGCCATGGAGTAG
Transcript >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTC
TTTGCGAAACCTTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCG
ACCTTCCCTCCAGACTCGGAGGTGAGGTATGCGCAGACCCAAAACGATAACCTTCGGGACGAGTACCTGGCACTA
TTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCTGATGCCTTAAATATTTGG
ATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTATGTCCAAGTTGTTGGCAGG
AAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTCCCTCCCGCCACCTTCACT
CGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTCGCAACTTGGGATCCGGAC
GAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACTCTCGAGCCTGGCGACATG
CTGTATTTGCCGGCCCTGTGGTACCACAAAGTCTCACAATCTTGCCTGGAAGGCGGTGAGGGCTTTAATGTTGCA
ATTAATTACTGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACGCAGCCTCGGCACA
GACCAGGACGCCATGGAGTAG
Gene >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGGTAAGCAGCCGCCAATCGTCACTTTTGCCCTCAGTCTACATATACT
CCTTAACTGGTGGAGGCGAAGATTACGACAAAGAATATGTAATAAAATACAGGAAGAGGCCGGAGCGACGGGCGA
GTGAAACAAGGATTGAGGAACCCACTCGAGACGCCTGTAGCTCACGAGACCTGTAGATTTACTTGCTAACCGAGC
TCTTCGCCGGCTGCATAGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTCTTTGCGAAACC
TTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCGACCTTCCCTCC
AGACTCGGAGGTGAGGTATGCGCAGACCCGTCAGCCAGCTTCCCCCCTCTCCCCCGGGCCCGCGCAATTCCTCAG
TGGCCGGCCCTTCGTGATGCATTGATGGCCTACATCTGACTACAACTACAAGTTGCAGAAAACGATAACCTTCGG
GACGAGTACCTGGCACTATTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCT
GATGCCTTAAATATTTGGATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTAT
GTCCAAGTTGTTGGCAGGAAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTC
CCTCCCGCCACCTTCACTCGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTC
GCAACTTGGGATCCGGACGAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACT
CTCGAGCCTGGCGACATGCTGTATTTGCCGGCCCTGTGGTAAGTGAACAATGAATTGATTACGGATCAGAGCTTG
CTTCATGTCCTGGTCGTTGCCTTCCGTAGCGCCCGCCGTCATCAGATCTGTTGTATTCTTCGCGACGGCGCAGGA
GACTTGAAATCGATCTCTTCGGAAGCTGACGCAGCCCATCAAAGGTACCACAAAGTCTCACAATCTTGCCTGGAA
GGCGGTGAGGGCTTTAATGTTGCAATTAATTACTGGTCAGTCTTGCGCACCACCAACGTCCAATTTGTTTCTTCC
ACTGACCTATCTTTCTCGGACTAGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACG
CAGCCTCGGCACAGACCAGGACGCCATGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail