Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3187
Gene name
LocationContig_1811:3111..4645
Strand-
Gene length (bp)1534
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 3.7E-67 37 310

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 2 309 2.0E-51
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 2 309 3.0E-51
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 32 321 1.0E-42
sp|P59723|HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio GN=hif1an PE=2 SV=2 176 305 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3187
MATLSTMDPALRDLICTYNELNSPFVEELDSEPSPLEFMRFVARSAPFVVRGGASSWKATRKWNSAYLKSSLEGQ
TINVAVTPTGYADSPTFSPQHDVTVFAKPCEESQPFEQFLSYITRQETDSTFPPDSEVRYAQTQNDNLRDEYLAL
FPDVQKDIPFARIALQKSPDALNIWIGNSRSVTAIHKDNFENIYVQVVGRKHFLLLPPLCQPCMNEKLLPPATFT
REGQGLSLRLDEPCEPVPFATWDPDEAQADATSLSHLARPLRVTLEPGDMLYLPALWYHKVSQSCLEGGEGFNVA
INYWYDMEFRGTLFPLSVFLRSLGTDQDAME*
Coding >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTC
TTTGCGAAACCTTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCG
ACCTTCCCTCCAGACTCGGAGGTGAGGTATGCGCAGACCCAAAACGATAACCTTCGGGACGAGTACCTGGCACTA
TTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCTGATGCCTTAAATATTTGG
ATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTATGTCCAAGTTGTTGGCAGG
AAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTCCCTCCCGCCACCTTCACT
CGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTCGCAACTTGGGATCCGGAC
GAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACTCTCGAGCCTGGCGACATG
CTGTATTTGCCGGCCCTGTGGTACCACAAAGTCTCACAATCTTGCCTGGAAGGCGGTGAGGGCTTTAATGTTGCA
ATTAATTACTGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACGCAGCCTCGGCACA
GACCAGGACGCCATGGAGTAG
Transcript >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTC
TTTGCGAAACCTTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCG
ACCTTCCCTCCAGACTCGGAGGTGAGGTATGCGCAGACCCAAAACGATAACCTTCGGGACGAGTACCTGGCACTA
TTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCTGATGCCTTAAATATTTGG
ATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTATGTCCAAGTTGTTGGCAGG
AAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTCCCTCCCGCCACCTTCACT
CGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTCGCAACTTGGGATCCGGAC
GAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACTCTCGAGCCTGGCGACATG
CTGTATTTGCCGGCCCTGTGGTACCACAAAGTCTCACAATCTTGCCTGGAAGGCGGTGAGGGCTTTAATGTTGCA
ATTAATTACTGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACGCAGCCTCGGCACA
GACCAGGACGCCATGGAGTAG
Gene >Hirsu2|3187
ATGGCAACTCTTAGTACAATGGATCCTGCACTAAGGGACTTGATTTGCACATACAACGAGCTGAACAGCCCCTTC
GTAGAGGAGCTCGATTCGGAGCCAAGCCCCCTTGAGTTTATGCGCTTCGTCGCCCGCAGCGCACCATTTGTTGTC
CGTGGCGGAGCATCGTCTTGGAAAGCCACGCGGAAATGGAACTCGGCATACTTGAAATCTAGTCTGGAAGGTCAG
ACAATCAACGTTGCCGTCACTCCAACGGGGTAAGCAGCCGCCAATCGTCACTTTTGCCCTCAGTCTACATATACT
CCTTAACTGGTGGAGGCGAAGATTACGACAAAGAATATGTAATAAAATACAGGAAGAGGCCGGAGCGACGGGCGA
GTGAAACAAGGATTGAGGAACCCACTCGAGACGCCTGTAGCTCACGAGACCTGTAGATTTACTTGCTAACCGAGC
TCTTCGCCGGCTGCATAGCTACGCCGACTCACCAACATTTTCTCCCCAGCATGATGTCACCGTCTTTGCGAAACC
TTGTGAGGAGTCTCAGCCGTTCGAACAGTTCTTGTCCTACATCACTCGACAAGAGACCGATTCGACCTTCCCTCC
AGACTCGGAGGTGAGGTATGCGCAGACCCGTCAGCCAGCTTCCCCCCTCTCCCCCGGGCCCGCGCAATTCCTCAG
TGGCCGGCCCTTCGTGATGCATTGATGGCCTACATCTGACTACAACTACAAGTTGCAGAAAACGATAACCTTCGG
GACGAGTACCTGGCACTATTCCCTGATGTACAAAAGGATATACCTTTCGCTCGTATAGCCCTCCAGAAATCACCT
GATGCCTTAAATATTTGGATAGGAAATTCTCGGTCTGTTACAGCTATTCACAAGGACAACTTTGAGAATATCTAT
GTCCAAGTTGTTGGCAGGAAACATTTCCTTCTCTTGCCGCCCCTATGCCAACCTTGCATGAATGAGAAGCTCCTC
CCTCCCGCCACCTTCACTCGTGAGGGCCAAGGGCTATCTCTGCGCCTCGATGAGCCTTGCGAACCAGTTCCATTC
GCAACTTGGGATCCGGACGAGGCTCAAGCTGACGCTACCTCTCTGTCGCACCTCGCGAGGCCACTGCGTGTCACT
CTCGAGCCTGGCGACATGCTGTATTTGCCGGCCCTGTGGTAAGTGAACAATGAATTGATTACGGATCAGAGCTTG
CTTCATGTCCTGGTCGTTGCCTTCCGTAGCGCCCGCCGTCATCAGATCTGTTGTATTCTTCGCGACGGCGCAGGA
GACTTGAAATCGATCTCTTCGGAAGCTGACGCAGCCCATCAAAGGTACCACAAAGTCTCACAATCTTGCCTGGAA
GGCGGTGAGGGCTTTAATGTTGCAATTAATTACTGGTCAGTCTTGCGCACCACCAACGTCCAATTTGTTTCTTCC
ACTGACCTATCTTTCTCGGACTAGGTACGACATGGAGTTTCGTGGGACGTTGTTTCCGTTATCTGTGTTTCTACG
CAGCCTCGGCACAGACCAGGACGCCATGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail