Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3168
Gene name
LocationContig_1808:263..1634
Strand+
Gene length (bp)1371
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 3.1E-79 66 322
PF13460 NAD_binding_10 NAD(P)H-binding 2.8E-07 71 235

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23762|NMR1_NEUCR Nitrogen metabolite repression protein nmr OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmr PE=1 SV=2 1 456 0.0E+00
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 59 405 2.0E-119
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 153 320 6.0E-09
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 145 321 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3168
MPAQISGSVAGSLPIRIADDHTNGYRKQHKHSRSSYSESSPLAGSRNNSLTFRPPKRLMSAPNKTIAIINASGRQ
AASLIRVATAVGYRVRAQLRNLEGVVATEVSTNPNVTCLVGELYTRHEPTEANKDVTQNGPISGIGVNHELISNL
FLGAQLAFVNTTFYGDELQIGMALADAAKAAGVQHYVYSSMPDHSAYNRNWPSLPLWAAKHKVEDYVRALDLPAT
FVYTGIYNNNFTSLLYPLFCMELRRDGSFVWQAPFHEDVKLPWLDAEHDVGPAILQIFKDGVAKWKGERVALAYE
HLTPREACDLFSRGVGRPVHYVRGPIEIKVRIPAGYREQLEALAKLFRADEADPKKQPPYFGDPKLEASCPAEAL
ELWEGPRGLEEYAREMFPLEEEANGLTWMLDEDDHDDKVHATAASVEQLKINDDDGEDGSDDEDDGLVMRGLKRD
EEQWLA*
Coding >Hirsu2|3168
ATGCCCGCGCAAATCTCGGGCTCCGTGGCGGGGAGCCTGCCCATCCGCATCGCCGACGACCACACCAACGGCTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCGTACTCGGAGTCGTCGCCCCTGGCCGGCTCGAGGAACAATTCCCTG
ACCTTCCGCCCCCCGAAGCGGCTCATGTCGGCGCCCAACAAGACCATCGCCATCATCAACGCCAGCGGCCGCCAG
GCGGCCTCGCTCATCCGCGTCGCCACCGCCGTCGGCTACCGCGTCCGCGCCCAGCTGCGCAACCTCGAGGGCGTC
GTCGCCACCGAGGTGTCGACGAACCCCAATGTCACCTGCCTCGTCGGCGAACTCTATACCCGGCACGAGCCGACC
GAGGCCAACAAGGATGTGACGCAAAACGGGCCCATTTCCGGCATCGGCGTCAACCACGAGCTCATCTCCAACCTC
TTCCTCGGCGCCCAGCTGGCCTTTGTCAACACCACCTTCTACGGCGACGAGCTCCAGATCGGCATGGCCCTCGCC
GACGCCGCCAAGGCCGCCGGCGTCCAGCACTACGTCTACTCGTCCATGCCCGACCACTCCGCCTACAACAGGAAC
TGGCCCTCCCTGCCGCTCTGGGCCGCCAAGCACAAGGTCGAGGACTACGTCCGCGCCCTCGATCTGCCCGCCACC
TTCGTCTACACCGGCATCTACAACAACAACTTCACCTCGCTGCTCTACCCCCTCTTCTGCATGGAGCTCCGCCGG
GACGGGTCCTTCGTCTGGCAGGCGCCCTTCCACGAGGACGTCAAGCTGCCCTGGCTGGACGCCGAGCACGACGTC
GGCCCCGCCATCCTCCAGATCTTCAAGGACGGCGTGGCCAAGTGGAAGGGCGAGCGCGTGGCGCTGGCCTACGAG
CACCTGACGCCGAGGGAGGCCTGCGACCTCTTCTCCCGCGGCGTCGGCCGGCCCGTCCACTACGTGAGGGGCCCC
ATCGAGATCAAGGTCCGCATCCCGGCCGGATACCGGGAACAGCTCGAGGCGCTGGCCAAGCTGTTCCGGGCCGAC
GAGGCCGACCCCAAGAAGCAGCCGCCCTACTTCGGCGACCCCAAGCTCGAGGCCAGCTGCCCCGCCGAGGCGCTG
GAGCTGTGGGAGGGCCCGCGGGGGCTGGAGGAATACGCCCGGGAGATGTTCCCGCTGGAGGAGGAGGCCAACGGG
CTGACGTGGATGCTCGACGAGGACGACCACGATGACAAGGTGCACGCGACGGCCGCCTCGGTCGAGCAGCTCAAG
ATCAACGACGACGACGGCGAGGACGGGTCCGACGACGAGGACGACGGCCTGGTCATGCGGGGCCTGAAGCGCGAC
GAGGAACAGTGGCTGGCGTGA
Transcript >Hirsu2|3168
ATGCCCGCGCAAATCTCGGGCTCCGTGGCGGGGAGCCTGCCCATCCGCATCGCCGACGACCACACCAACGGCTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCGTACTCGGAGTCGTCGCCCCTGGCCGGCTCGAGGAACAATTCCCTG
ACCTTCCGCCCCCCGAAGCGGCTCATGTCGGCGCCCAACAAGACCATCGCCATCATCAACGCCAGCGGCCGCCAG
GCGGCCTCGCTCATCCGCGTCGCCACCGCCGTCGGCTACCGCGTCCGCGCCCAGCTGCGCAACCTCGAGGGCGTC
GTCGCCACCGAGGTGTCGACGAACCCCAATGTCACCTGCCTCGTCGGCGAACTCTATACCCGGCACGAGCCGACC
GAGGCCAACAAGGATGTGACGCAAAACGGGCCCATTTCCGGCATCGGCGTCAACCACGAGCTCATCTCCAACCTC
TTCCTCGGCGCCCAGCTGGCCTTTGTCAACACCACCTTCTACGGCGACGAGCTCCAGATCGGCATGGCCCTCGCC
GACGCCGCCAAGGCCGCCGGCGTCCAGCACTACGTCTACTCGTCCATGCCCGACCACTCCGCCTACAACAGGAAC
TGGCCCTCCCTGCCGCTCTGGGCCGCCAAGCACAAGGTCGAGGACTACGTCCGCGCCCTCGATCTGCCCGCCACC
TTCGTCTACACCGGCATCTACAACAACAACTTCACCTCGCTGCTCTACCCCCTCTTCTGCATGGAGCTCCGCCGG
GACGGGTCCTTCGTCTGGCAGGCGCCCTTCCACGAGGACGTCAAGCTGCCCTGGCTGGACGCCGAGCACGACGTC
GGCCCCGCCATCCTCCAGATCTTCAAGGACGGCGTGGCCAAGTGGAAGGGCGAGCGCGTGGCGCTGGCCTACGAG
CACCTGACGCCGAGGGAGGCCTGCGACCTCTTCTCCCGCGGCGTCGGCCGGCCCGTCCACTACGTGAGGGGCCCC
ATCGAGATCAAGGTCCGCATCCCGGCCGGATACCGGGAACAGCTCGAGGCGCTGGCCAAGCTGTTCCGGGCCGAC
GAGGCCGACCCCAAGAAGCAGCCGCCCTACTTCGGCGACCCCAAGCTCGAGGCCAGCTGCCCCGCCGAGGCGCTG
GAGCTGTGGGAGGGCCCGCGGGGGCTGGAGGAATACGCCCGGGAGATGTTCCCGCTGGAGGAGGAGGCCAACGGG
CTGACGTGGATGCTCGACGAGGACGACCACGATGACAAGGTGCACGCGACGGCCGCCTCGGTCGAGCAGCTCAAG
ATCAACGACGACGACGGCGAGGACGGGTCCGACGACGAGGACGACGGCCTGGTCATGCGGGGCCTGAAGCGCGAC
GAGGAACAGTGGCTGGCGTGA
Gene >Hirsu2|3168
ATGCCCGCGCAAATCTCGGGCTCCGTGGCGGGGAGCCTGCCCATCCGCATCGCCGACGACCACACCAACGGCTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCGTACTCGGAGTCGTCGCCCCTGGCCGGCTCGAGGAACAATTCCCTG
ACCTTCCGCCCCCCGAAGCGGCTCATGTCGGCGCCCAACAAGACCATCGCCATCATCAACGCCAGCGGCCGCCAG
GCGGCCTCGCTCATCCGCGTCGCCACCGCCGTCGGCTACCGCGTCCGCGCCCAGCTGCGCAACCTCGAGGGCGTC
GTCGCCACCGAGGTGTCGACGAACCCCAATGTCACCTGCCTCGTCGGCGAACTCTATACCCGGCACGAGCCGACC
GAGGCCAACAAGGATGTGACGCAAAACGGGCCCATTTCCGGCATCGGCGTCAACCACGAGCTCATCTCCAACCTC
TTCCTCGGCGCCCAGCTGGCCTTTGTCAACACCACCTTCTACGGCGACGAGCTCCAGATCGGCATGGCCCTCGCC
GACGCCGCCAAGGCCGCCGGCGTCCAGCACTACGTCTACTCGTCCATGCCCGACCACTCCGCCTACAACAGGAAC
TGGCCCTCCCTGCCGCTCTGGGCCGCCAAGCACAAGGTCGAGGACTACGTCCGCGCCCTCGATCTGCCCGCCACC
TTCGTCTACACCGGCATCTACAACAACAACTTCACCTCGCTGCTCTACCCCCTCTTCTGCATGGAGCTCCGCCGG
GACGGGTCCTTCGTCTGGCAGGCGCCCTTCCACGAGGACGTCAAGCTGCCCTGGCTGGACGCCGAGCACGACGTC
GGCCCCGCCATCCTCCAGATCTTCAAGGACGGCGTGGCCAAGTGGAAGGGCGAGCGCGTGGCGCTGGCCTACGAG
CACCTGACGCCGAGGGAGGCCTGCGACCTCTTCTCCCGCGGCGTCGGCCGGCCCGTCCACTACGTGAGGGGCCCC
ATCGAGATCAAGGTCCGCATCCCGGCCGGATACCGGGAACAGCTCGAGGCGCTGGCCAAGCTGTTCCGGGCCGAC
GAGGCCGACCCCAAGAAGCAGCCGCCCTACTTCGGCGACCCCAAGCTCGAGGCCAGCTGCCCCGCCGAGGCGCTG
GAGCTGTGGGAGGGCCCGCGGGGGCTGGAGGAATACGCCCGGGAGATGTTCCCGCTGGAGGAGGAGGCCAACGGG
CTGACGTGGATGCTCGACGAGGACGACCACGATGACAAGGTGCACGCGACGGCCGCCTCGGTCGAGCAGCTCAAG
ATCAACGACGACGACGGCGAGGACGGGTCCGACGACGAGGACGACGGCCTGGTCATGCGGGGCCTGAAGCGCGAC
GAGGAACAGTGGCTGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail