Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3157
Gene name
LocationContig_1802:551..1795
Strand-
Gene length (bp)1244
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10445 DUF2456 Protein of unknown function (DUF2456) 7.3E-20 185 252

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74505|YJD2_SCHPO Uncharacterized protein C594.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC594.02c PE=1 SV=1 68 258 3.0E-28
sp|P38740|YHC6_YEAST Uncharacterized protein YHL026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL026C PE=1 SV=2 65 256 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 110 132 22
3 193 215 22
4 235 257 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3157
MGRRDWPARLAFWKRAGAGRDKEEAAAETPPRDEEAQTAGDGDDDDDDDDKVMEPSSRLTGHQAFYMFVLDGIGG
MCLSGGINFAIAYGMYRTQDLRRHPIRLFQLPNTLAGDAAITIVVQCLITWLIELGLAGHDVKHGGVQPIGWLRE
PRNCLARWFFWLPRDEAEAGTARLPAVRVFRFWPLFGQVLRGALFGCVAFFPFWPVAVGIMTAAGHHHDGDWYYQ
HRWAPQVYKLILGGVLGLVTTPLMAMFWLVRAGWDVKRRDAAADAAAAASSSSPSSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPPPTTPTEP*
Coding >Hirsu2|3157
ATGGGACGGCGCGACTGGCCGGCTCGCTTGGCCTTCTGGAAGAGGGCCGGGGCCGGCAGGGACAAGGAGGAGGCG
GCGGCCGAGACGCCGCCGCGCGACGAGGAGGCCCAGACGGCGGGCGATGGCGACGACGACGACGACGACGACGAC
AAGGTCATGGAGCCCAGCTCGCGGCTGACGGGCCACCAGGCCTTCTACATGTTCGTCCTTGACGGCATCGGAGGC
ATGTGCCTCTCGGGCGGCATCAACTTTGCCATTGCCTACGGCATGTACCGGACGCAGGACCTACGGCGGCACCCG
ATCCGGCTGTTCCAGCTGCCCAACACGCTGGCGGGCGACGCGGCCATCACGATCGTGGTGCAGTGCCTCATCACC
TGGCTGATCGAGCTCGGGCTGGCCGGGCACGACGTCAAGCACGGCGGCGTGCAGCCCATCGGCTGGCTGCGCGAG
CCGCGCAACTGCCTGGCCCGCTGGTTCTTCTGGCTGCCGCGGGACGAGGCCGAGGCCGGGACGGCGCGGCTGCCG
GCCGTCCGCGTCTTCCGCTTCTGGCCGCTGTTCGGCCAGGTCCTGCGCGGCGCCCTCTTCGGCTGCGTCGCCTTC
TTCCCCTTCTGGCCCGTCGCCGTCGGCATCATGACGGCCGCCGGCCACCACCACGACGGCGACTGGTACTACCAG
CACCGCTGGGCGCCGCAGGTCTACAAGCTCATCCTCGGCGGCGTGCTGGGCCTGGTGACGACGCCGCTCATGGCC
ATGTTCTGGCTTGTCCGTGCCGGCTGGGACGTGAAGCGCCGGGATGCCGCCGCCGATGCTGCTGCTGCCGCCTCG
TCGTCGTCGCCGTCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCGCCGCCGACGACGCCGACCGAGCCGTGA
Transcript >Hirsu2|3157
ATGGGACGGCGCGACTGGCCGGCTCGCTTGGCCTTCTGGAAGAGGGCCGGGGCCGGCAGGGACAAGGAGGAGGCG
GCGGCCGAGACGCCGCCGCGCGACGAGGAGGCCCAGACGGCGGGCGATGGCGACGACGACGACGACGACGACGAC
AAGGTCATGGAGCCCAGCTCGCGGCTGACGGGCCACCAGGCCTTCTACATGTTCGTCCTTGACGGCATCGGAGGC
ATGTGCCTCTCGGGCGGCATCAACTTTGCCATTGCCTACGGCATGTACCGGACGCAGGACCTACGGCGGCACCCG
ATCCGGCTGTTCCAGCTGCCCAACACGCTGGCGGGCGACGCGGCCATCACGATCGTGGTGCAGTGCCTCATCACC
TGGCTGATCGAGCTCGGGCTGGCCGGGCACGACGTCAAGCACGGCGGCGTGCAGCCCATCGGCTGGCTGCGCGAG
CCGCGCAACTGCCTGGCCCGCTGGTTCTTCTGGCTGCCGCGGGACGAGGCCGAGGCCGGGACGGCGCGGCTGCCG
GCCGTCCGCGTCTTCCGCTTCTGGCCGCTGTTCGGCCAGGTCCTGCGCGGCGCCCTCTTCGGCTGCGTCGCCTTC
TTCCCCTTCTGGCCCGTCGCCGTCGGCATCATGACGGCCGCCGGCCACCACCACGACGGCGACTGGTACTACCAG
CACCGCTGGGCGCCGCAGGTCTACAAGCTCATCCTCGGCGGCGTGCTGGGCCTGGTGACGACGCCGCTCATGGCC
ATGTTCTGGCTTGTCCGTGCCGGCTGGGACGTGAAGCGCCGGGATGCCGCCGCCGATGCTGCTGCTGCCGCCTCG
TCGTCGTCGCCGTCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCGCCGCCGACGACGCCGACCGAGCCGTGA
Gene >Hirsu2|3157
ATGGGACGGCGCGACTGGCCGGCTCGCTTGGCCTTCTGGAAGAGGGCCGGGGCCGGCAGGGACAAGGAGGAGGCG
GCGGCCGAGACGCCGCCGCGCGACGAGGAGGCCCAGACGGCGGGCGATGGCGACGACGACGACGACGACGACGAC
AAGGTCATGGAGCCCAGCTCGCGGCTGACGGGCCACCAGGCCTTCTACATGTTCGTCCTTGACGGCATCGGAGGC
ATGTGCCTCTCGGGCGGCATCAACTTTGCCATTGCCTACGGTACGCACCGCCAGATCCATCATCTCCTCCCCCTC
CATCACGAGCTCTCCAGCCCTCCCCCCTGAACCCTGGTCGCCCAGTCCGCCGTCATCCCGTCCCTCCATCCNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCTTCCTCTCCGGGGCGGAAACCGGAGGAGCCCGGCTGA
CGACGAACCTCGCAGGCATGTACCGGACGCAGGACCTACGGCGGCACCCGATCCGGCTGTTCCAGCTGCCCAACA
CGCTGGCGGGCGACGCGGCCATCACGATCGTGGTGCAGTGCCTCATCACCTGGCTGATCGAGCTCGGGCTGGCCG
GGCACGACGTCAAGCACGGCGGCGTGCAGCCCATCGGCTGGCTGCGCGAGCCGCGCAACTGCCTGGCCCGCTGGT
TCTTCTGGCTGCCGCGGGACGAGGCCGAGGCCGGGACGGCGCGGCTGCCGGCCGTCCGCGTCTTCCGCTTCTGGC
CGCTGTTCGGCCAGGTCCTGCGCGGCGCCCTCTTCGGCTGCGTCGCCTTCTTCCCCTTCTGGCCCGTCGCCGTCG
GCATCATGACGGCCGCCGGCCACCACCACGACGGCGACTGGTACTACCAGCACCGCTGGGCGCCGCAGGTCTACA
AGCTCATCCTCGGCGGCGTGCTGGGCCTGGTGACGACGCCGCTCATGGCCATGTTCTGGCTTGTCCGTGCCGGCT
GGGACGTGAAGCGCCGGGATGCCGCCGCCGATGCTGCTGCTGCCGCCTCGTCGTCGTCGCCGTCGTCNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNGCCGCCGCCGACGACGCCGACCGAGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail