Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3139
Gene name
LocationContig_18:66789..67596
Strand-
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5837 0.1637 0.8316 0.1519 0.3591 0.2594 0.131 0.2518 0.3693 0.033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup98
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3581
Ophiocordyceps australis map64 (Brazil) OphauB2|324
Ophiocordyceps camponoti-floridani Ophcf2|01007
Ophiocordyceps camponoti-rufipedis Ophun1|7143
Ophiocordyceps kimflemingae Ophio5|7930
Ophiocordyceps subramaniannii Hirsu2|156
Ophiocordyceps subramaniannii Hirsu2|2137
Ophiocordyceps subramaniannii Hirsu2|3139 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3419
Ophiocordyceps subramaniannii Hirsu2|5164
Ophiocordyceps subramaniannii Hirsu2|7455
Ophiocordyceps subramaniannii Hirsu2|9490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3139
MGPKNDRLGFILNWGIVFDTLGKNLTGPNNLIIYDLEENRVHCQVDISKKFATVGRGGMQDLEFDEDGNVFVIET
YGGILLRVSSDCSTVEEWYKDPLLAPTAGFTGLARVNDIILLVDQTKKKLYRTRTGLEGKGKAETVEITGLHPNS
AAQNMSVTDGLYCPPKYAGNCCLLSDNDIGTTVFWSDDGWFSAKIHSPIPNKFLNDQPRGSSTASVEMAGRIFVI
TEWFMDGAKAQRGAGKPGDRTEFPMQDITALVDERCKPNIIMA*
Coding >Hirsu2|3139
ATGGGCCCTAAAAACGATCGGTTGGGCTTTATACTGAACTGGGGCATCGTCTTCGACACACTTGGAAAGAACCTT
ACGGGTCCCAATAACCTCATCATCTATGATTTAGAGGAGAATCGCGTCCATTGCCAGGTCGACATCAGTAAGAAG
TTCGCTACGGTTGGTCGGGGAGGCATGCAAGACCTCGAGTTCGATGAGGATGGAAACGTCTTTGTGATAGAAACT
TACGGCGGAATCCTACTTCGTGTTAGCTCCGACTGCTCCACGGTCGAAGAGTGGTATAAGGATCCACTGCTTGCT
CCCACCGCCGGCTTCACTGGTCTAGCCAGAGTCAACGACATCATATTGCTTGTCGACCAGACTAAGAAGAAGCTC
TACCGCACCAGGACGGGTTTGGAGGGCAAGGGAAAGGCCGAGACAGTGGAAATCACGGGCCTGCACCCGAACTCG
GCAGCTCAGAATATGAGCGTCACGGACGGCCTATACTGCCCACCGAAGTACGCGGGAAACTGCTGCCTCTTGTCC
GATAATGACATTGGAACCACCGTCTTTTGGTCCGATGATGGATGGTTCAGCGCCAAGATACACAGTCCCATCCCA
AACAAGTTTCTCAACGACCAACCTCGTGGATCTAGCACCGCCTCCGTCGAGATGGCCGGGAGGATTTTCGTAATA
ACCGAATGGTTTATGGATGGAGCCAAGGCTCAGCGCGGTGCGGGAAAGCCTGGAGACAGGACCGAGTTCCCTATG
CAAGATATTACGGCGCTGGTGGACGAGAGATGCAAACCTAACATTATTATGGCCTAA
Transcript >Hirsu2|3139
ATGGGCCCTAAAAACGATCGGTTGGGCTTTATACTGAACTGGGGCATCGTCTTCGACACACTTGGAAAGAACCTT
ACGGGTCCCAATAACCTCATCATCTATGATTTAGAGGAGAATCGCGTCCATTGCCAGGTCGACATCAGTAAGAAG
TTCGCTACGGTTGGTCGGGGAGGCATGCAAGACCTCGAGTTCGATGAGGATGGAAACGTCTTTGTGATAGAAACT
TACGGCGGAATCCTACTTCGTGTTAGCTCCGACTGCTCCACGGTCGAAGAGTGGTATAAGGATCCACTGCTTGCT
CCCACCGCCGGCTTCACTGGTCTAGCCAGAGTCAACGACATCATATTGCTTGTCGACCAGACTAAGAAGAAGCTC
TACCGCACCAGGACGGGTTTGGAGGGCAAGGGAAAGGCCGAGACAGTGGAAATCACGGGCCTGCACCCGAACTCG
GCAGCTCAGAATATGAGCGTCACGGACGGCCTATACTGCCCACCGAAGTACGCGGGAAACTGCTGCCTCTTGTCC
GATAATGACATTGGAACCACCGTCTTTTGGTCCGATGATGGATGGTTCAGCGCCAAGATACACAGTCCCATCCCA
AACAAGTTTCTCAACGACCAACCTCGTGGATCTAGCACCGCCTCCGTCGAGATGGCCGGGAGGATTTTCGTAATA
ACCGAATGGTTTATGGATGGAGCCAAGGCTCAGCGCGGTGCGGGAAAGCCTGGAGACAGGACCGAGTTCCCTATG
CAAGATATTACGGCGCTGGTGGACGAGAGATGCAAACCTAACATTATTATGGCCTAA
Gene >Hirsu2|3139
ATGGGCCCTAAAAACGATCGGTTGGGCTTTATACTGAACTGGGGCATCGTCTTCGACACACTTGGAAAGAACCTT
ACGGGTCCCAATAACCTCATCATCTATGATTTAGAGGAGAATCGCGTCCATTGCCAGGTCGACATCAGTAAGAAG
TTCGCTACGGTTGGTCGGGGAGGCATGCAAGACCTCGAGTTCGATGAGGATGGAAACGTCTTTGTGATAGAAACT
TACGGCGGAATCCTACTTCGTGTTAGCTCCGACTGCTCCACGGTCGAAGAGTGGTATAAGGATCCACTGCTTGCT
CCCACCGCCGGCTTCACTGGTCTAGCCAGAGTCAACGACATCATATTGCTTGTCGACCAGACTAAGAAGAAGCTC
TACCGCACCAGGACGGGTTTGGAGGGCAAGGGAAAGGCCGAGACAGTGGAAATCACGGGCCTGCACCCGAACTCG
GCAGCTCAGAATATGAGCGTCACGGACGGCCTATACTGCCCACCGAAGTACGCGGGAAACTGCTGCCTCTTGTCC
GATAATGACATTGGAACCACCGTCTTTTGGTCCGATGATGGATGGTTCAGCGCCAAGATACACAGTCCCATCCCA
AACAAGTTTCTCAACGACCAACCTCGTGGATCTAGCACCGCCTCCGTCGAGATGGCCGGGAGGATTTTCGTAATA
ACCGAATGGTTTATGGATGGAGCCAAGGCTCAGCGCGGTGCGGGAAAGCCTGGAGACAGGACCGAGTTCCCTATG
CAAGATATTACGGCGCTGGTGGACGAGAGATGCAAACCTAACATTATTATGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail