Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3138
Gene name
LocationContig_18:64190..64880
Strand+
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.3E-06 122 193

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09927|AZET_SCHPO L-azetidine-2-carboxylic acid acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr1 PE=1 SV=1 57 218 8.0E-35
sp|P35208|SPT10_YEAST Protein SPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT10 PE=1 SV=1 19 223 3.0E-30

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3138
MPAILDDPSSAPIKRWPSRAETSLPAGIKPRQVTLRDGQTNATISPFTSQEQIPPSLLAFLCRQFNQEIESGDTY
PMVDPFTPEAFGAYWVQSFAAIMLLDAVDLQADEADRLDWSKVCLGSYYIKPNYPGRSSHVCNAGFLVTEAARNR
GVGRLLGESYVDWAPQLGYCYSVFNLVYETNVASCKIWDQLGFKQIGRVKGCGKLKSYPGQLIDAIVYGRELVSD
AQNS*
Coding >Hirsu2|3138
ATGCCAGCAATTCTAGACGACCCAAGCAGCGCACCGATCAAGCGATGGCCCTCTCGAGCCGAGACCTCGCTTCCG
GCGGGAATTAAACCAAGACAAGTCACTCTTCGGGACGGCCAAACAAACGCAACCATCTCCCCATTCACATCGCAG
GAACAGATCCCGCCATCACTGCTAGCTTTCCTGTGTAGGCAGTTCAATCAAGAAATTGAGTCTGGCGACACGTAC
CCGATGGTGGACCCGTTCACGCCGGAGGCCTTTGGAGCCTACTGGGTCCAAAGCTTTGCCGCAATCATGCTTCTT
GACGCAGTAGACCTACAAGCAGACGAAGCAGATCGCCTAGACTGGTCTAAGGTCTGCTTGGGTAGTTACTATATC
AAGCCAAACTACCCAGGCCGCAGCAGCCACGTCTGCAATGCTGGATTCCTAGTCACCGAGGCAGCACGCAACCGA
GGAGTCGGACGCTTGTTGGGGGAGAGCTATGTCGACTGGGCGCCCCAACTAGGCTATTGCTACTCTGTGTTCAAC
CTGGTGTATGAGACCAATGTCGCTTCGTGCAAGATTTGGGATCAGCTCGGCTTCAAGCAGATTGGCCGCGTCAAG
GGCTGCGGAAAGCTCAAGAGTTATCCTGGACAGCTGATCGATGCAATTGTTTACGGCCGTGAGCTTGTCAGCGAT
GCGCAAAACTCATGA
Transcript >Hirsu2|3138
ATGCCAGCAATTCTAGACGACCCAAGCAGCGCACCGATCAAGCGATGGCCCTCTCGAGCCGAGACCTCGCTTCCG
GCGGGAATTAAACCAAGACAAGTCACTCTTCGGGACGGCCAAACAAACGCAACCATCTCCCCATTCACATCGCAG
GAACAGATCCCGCCATCACTGCTAGCTTTCCTGTGTAGGCAGTTCAATCAAGAAATTGAGTCTGGCGACACGTAC
CCGATGGTGGACCCGTTCACGCCGGAGGCCTTTGGAGCCTACTGGGTCCAAAGCTTTGCCGCAATCATGCTTCTT
GACGCAGTAGACCTACAAGCAGACGAAGCAGATCGCCTAGACTGGTCTAAGGTCTGCTTGGGTAGTTACTATATC
AAGCCAAACTACCCAGGCCGCAGCAGCCACGTCTGCAATGCTGGATTCCTAGTCACCGAGGCAGCACGCAACCGA
GGAGTCGGACGCTTGTTGGGGGAGAGCTATGTCGACTGGGCGCCCCAACTAGGCTATTGCTACTCTGTGTTCAAC
CTGGTGTATGAGACCAATGTCGCTTCGTGCAAGATTTGGGATCAGCTCGGCTTCAAGCAGATTGGCCGCGTCAAG
GGCTGCGGAAAGCTCAAGAGTTATCCTGGACAGCTGATCGATGCAATTGTTTACGGCCGTGAGCTTGTCAGCGAT
GCGCAAAACTCATGA
Gene >Hirsu2|3138
ATGCCAGCAATTCTAGACGACCCAAGCAGCGCACCGATCAAGCGATGGCCCTCTCGAGCCGAGACCTCGCTTCCG
GCGGGAATTAAACCAAGACAAGTCACTCTTCGGGACGGCCAAACAAACGCAACCATCTCCCCATTCACATCGCAG
GAACAGATCCCGCCATCACTGCTAGCTTTCCTGTGTAGGCAGTTCAATCAAGAAATTGAGTCTGGCGACACGTAC
CCGATGGTGGACCCGTTCACGCCGGAGGCCTTTGGAGCCTACTGGGTCCAAAGCTTTGCCGCAATCATGCTTCTT
GACGCAGTAGACCTACAAGCAGACGAAGCAGATCGCCTAGACTGGTCTAAGGTCTGCTTGGGTAGTTACTATATC
AAGCCAAACTACCCAGGCCGCAGCAGCCACGTCTGCAATGCTGGATTCCTAGTCACCGAGGCAGCACGCAACCGA
GGAGTCGGACGCTTGTTGGGGGAGAGCTATGTCGACTGGGCGCCCCAACTAGGCTATTGCTACTCTGTGTTCAAC
CTGGTGTATGAGACCAATGTCGCTTCGTGCAAGATTTGGGATCAGCTCGGCTTCAAGCAGATTGGCCGCGTCAAG
GGCTGCGGAAAGCTCAAGAGTTATCCTGGACAGCTGATCGATGCAATTGTTTACGGCCGTGAGCTTGTCAGCGAT
GCGCAAAACTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail