Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3130
Gene name
LocationContig_18:37700..38714
Strand+
Gene length (bp)1014
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4HVS2|GNT1_GIBZE Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GNT1 PE=3 SV=1 54 309 1.0E-15
sp|Q6FQ15|GNT1_CANGA Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GNT1 PE=3 SV=1 48 179 3.0E-07
sp|H2KYQ5|GYG1_CAEEL Glycogenin-1 OS=Caenorhabditis elegans GN=gyg-1 PE=1 SV=1 52 301 5.0E-07
sp|Q4WBL2|GNT1_ASPFU Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gnt1 PE=3 SV=1 129 306 2.0E-06
sp|Q12096|GNT1_YEAST Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNT1 PE=1 SV=1 54 182 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3130
MWAFFPRSWQRRLSAKTIVCILAACILAFNLWAQLKTRQSSGQLFRHPLDRSRAYVFYATNDIYACSVMVNVHIL
RHTLRTRYRVSVLISHEVSSDIRRGLDAMGAAVLVQDPPPLHQDTDVPYYKDCLLKLMAFKMHELDSSLNQILVL
DSDQLILKNLDDTFDLPAPEFAAPSAYWLGNNQMSSTCMLIRPNASLWNRVEPALASVGVQRYDMDIVNDLFRSQ
NYRLSESYNTLNSHWEDWNVPHWFRAENRSSPITSLSPSDEIKPQPASDQDLKALYRQAKVLHFSAVGKPWDLSV
AELIKERPNAHPLLQHQWKAWRSTANKICPRHFVDDI*
Coding >Hirsu2|3130
ATGTGGGCCTTCTTCCCTCGGAGCTGGCAGCGCAGGCTCAGCGCGAAGACAATCGTCTGTATCTTGGCCGCATGC
ATTCTGGCTTTCAATCTCTGGGCACAGCTGAAAACCCGTCAAAGCTCCGGGCAATTGTTTCGTCACCCTCTTGAT
CGCTCGAGAGCCTACGTCTTCTATGCGACCAACGACATATATGCCTGCTCCGTCATGGTCAATGTACACATCTTG
CGTCATACACTGCGTACCCGGTACCGAGTCTCTGTACTCATCTCCCACGAGGTGTCTTCGGATATCCGGCGGGGC
CTGGACGCAATGGGCGCGGCGGTACTCGTGCAGGATCCTCCACCGCTTCACCAAGACACCGATGTCCCGTACTAC
AAAGATTGCCTACTTAAGTTAATGGCCTTCAAGATGCACGAACTTGACTCCTCTCTTAATCAAATTCTCGTCCTC
GACTCGGACCAACTCATTTTGAAGAACCTAGACGATACCTTCGATCTACCTGCACCCGAATTCGCTGCGCCGAGT
GCGTACTGGCTCGGGAACAATCAGATGTCAAGCACTTGTATGCTCATCCGTCCCAATGCATCCTTGTGGAATAGA
GTCGAGCCGGCTTTAGCGTCGGTAGGAGTGCAGAGGTACGACATGGATATTGTGAACGACCTGTTCCGCAGTCAA
AATTATAGACTGAGTGAAAGCTACAATACCCTGAACAGCCACTGGGAAGACTGGAATGTCCCGCACTGGTTTCGC
GCCGAGAACCGAAGCTCTCCAATAACCAGCTTGTCACCGAGCGACGAGATAAAGCCGCAGCCGGCTTCAGATCAA
GATCTCAAGGCCCTCTATCGCCAAGCCAAAGTCTTGCACTTCAGCGCTGTAGGCAAGCCCTGGGACCTGAGCGTC
GCTGAGCTCATAAAGGAAAGGCCGAATGCCCATCCATTACTTCAACATCAGTGGAAAGCTTGGAGGTCAACAGCG
AACAAAATATGCCCAAGACATTTTGTGGACGACATCTAA
Transcript >Hirsu2|3130
ATGTGGGCCTTCTTCCCTCGGAGCTGGCAGCGCAGGCTCAGCGCGAAGACAATCGTCTGTATCTTGGCCGCATGC
ATTCTGGCTTTCAATCTCTGGGCACAGCTGAAAACCCGTCAAAGCTCCGGGCAATTGTTTCGTCACCCTCTTGAT
CGCTCGAGAGCCTACGTCTTCTATGCGACCAACGACATATATGCCTGCTCCGTCATGGTCAATGTACACATCTTG
CGTCATACACTGCGTACCCGGTACCGAGTCTCTGTACTCATCTCCCACGAGGTGTCTTCGGATATCCGGCGGGGC
CTGGACGCAATGGGCGCGGCGGTACTCGTGCAGGATCCTCCACCGCTTCACCAAGACACCGATGTCCCGTACTAC
AAAGATTGCCTACTTAAGTTAATGGCCTTCAAGATGCACGAACTTGACTCCTCTCTTAATCAAATTCTCGTCCTC
GACTCGGACCAACTCATTTTGAAGAACCTAGACGATACCTTCGATCTACCTGCACCCGAATTCGCTGCGCCGAGT
GCGTACTGGCTCGGGAACAATCAGATGTCAAGCACTTGTATGCTCATCCGTCCCAATGCATCCTTGTGGAATAGA
GTCGAGCCGGCTTTAGCGTCGGTAGGAGTGCAGAGGTACGACATGGATATTGTGAACGACCTGTTCCGCAGTCAA
AATTATAGACTGAGTGAAAGCTACAATACCCTGAACAGCCACTGGGAAGACTGGAATGTCCCGCACTGGTTTCGC
GCCGAGAACCGAAGCTCTCCAATAACCAGCTTGTCACCGAGCGACGAGATAAAGCCGCAGCCGGCTTCAGATCAA
GATCTCAAGGCCCTCTATCGCCAAGCCAAAGTCTTGCACTTCAGCGCTGTAGGCAAGCCCTGGGACCTGAGCGTC
GCTGAGCTCATAAAGGAAAGGCCGAATGCCCATCCATTACTTCAACATCAGTGGAAAGCTTGGAGGTCAACAGCG
AACAAAATATGCCCAAGACATTTTGTGGACGACATCTAA
Gene >Hirsu2|3130
ATGTGGGCCTTCTTCCCTCGGAGCTGGCAGCGCAGGCTCAGCGCGAAGACAATCGTCTGTATCTTGGCCGCATGC
ATTCTGGCTTTCAATCTCTGGGCACAGCTGAAAACCCGTCAAAGCTCCGGGCAATTGTTTCGTCACCCTCTTGAT
CGCTCGAGAGCCTACGTCTTCTATGCGACCAACGACATATATGCCTGCTCCGTCATGGTCAATGTACACATCTTG
CGTCATACACTGCGTACCCGGTACCGAGTCTCTGTACTCATCTCCCACGAGGTGTCTTCGGATATCCGGCGGGGC
CTGGACGCAATGGGCGCGGCGGTACTCGTGCAGGATCCTCCACCGCTTCACCAAGACACCGATGTCCCGTACTAC
AAAGATTGCCTACTTAAGTTAATGGCCTTCAAGATGCACGAACTTGACTCCTCTCTTAATCAAATTCTCGTCCTC
GACTCGGACCAACTCATTTTGAAGAACCTAGACGATACCTTCGATCTACCTGCACCCGAATTCGCTGCGCCGAGT
GCGTACTGGCTCGGGAACAATCAGATGTCAAGCACTTGTATGCTCATCCGTCCCAATGCATCCTTGTGGAATAGA
GTCGAGCCGGCTTTAGCGTCGGTAGGAGTGCAGAGGTACGACATGGATATTGTGAACGACCTGTTCCGCAGTCAA
AATTATAGACTGAGTGAAAGCTACAATACCCTGAACAGCCACTGGGAAGACTGGAATGTCCCGCACTGGTTTCGC
GCCGAGAACCGAAGCTCTCCAATAACCAGCTTGTCACCGAGCGACGAGATAAAGCCGCAGCCGGCTTCAGATCAA
GATCTCAAGGCCCTCTATCGCCAAGCCAAAGTCTTGCACTTCAGCGCTGTAGGCAAGCCCTGGGACCTGAGCGTC
GCTGAGCTCATAAAGGAAAGGCCGAATGCCCATCCATTACTTCAACATCAGTGGAAAGCTTGGAGGTCAACAGCG
AACAAAATATGCCCAAGACATTTTGTGGACGACATCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail