Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|313
Gene name
LocationContig_106:16262..18279
Strand+
Gene length (bp)2017
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 6.9E-68 48 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 28 508 2.0E-130
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 28 502 6.0E-128
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 25 491 4.0E-40
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 17 482 4.0E-38
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 17 482 4.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 28 508 2.0E-130
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 28 502 6.0E-128
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 25 491 4.0E-40
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 17 482 4.0E-38
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 17 482 4.0E-38
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 16 482 6.0E-37
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 43 492 6.0E-35
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 39 460 2.0E-34
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 33 491 2.0E-34
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 28 503 1.0E-32
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 29 493 1.0E-29
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 248 485 1.0E-28
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 248 485 3.0E-28
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 28 493 6.0E-28
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 36 491 1.0E-27
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 254 472 1.0E-26
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 36 488 2.0E-25
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 248 504 5.0E-25
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 248 493 1.0E-24
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 248 504 1.0E-24
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 250 477 8.0E-24
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 278 473 1.0E-23
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 262 473 3.0E-23
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 186 472 3.0E-23
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 278 473 7.0E-23
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 157 473 8.0E-23
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 278 485 1.0E-22
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 277 457 1.0E-22
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 266 473 1.0E-22
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 271 473 3.0E-22
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 142 477 3.0E-22
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 153 503 6.0E-22
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 157 473 7.0E-22
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 248 487 7.0E-22
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 252 471 9.0E-22
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 28 474 9.0E-22
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 305 485 1.0E-21
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 252 490 2.0E-21
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 270 473 2.0E-21
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 250 475 3.0E-21
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 277 485 3.0E-21
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 136 505 4.0E-21
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 78 474 4.0E-21
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 271 473 4.0E-21
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 248 474 5.0E-21
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 278 484 6.0E-21
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 147 478 7.0E-21
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 264 474 7.0E-21
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 265 485 8.0E-21
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 252 471 8.0E-21
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 252 472 9.0E-21
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 208 472 1.0E-20
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 277 471 2.0E-20
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 248 487 2.0E-20
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 278 473 2.0E-20
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 305 487 2.0E-20
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 303 474 2.0E-20
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 51 486 2.0E-20
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 255 467 3.0E-20
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 283 493 3.0E-20
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 175 472 3.0E-20
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 188 481 3.0E-20
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 277 485 4.0E-20
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 251 485 5.0E-20
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 101 473 5.0E-20
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 153 473 6.0E-20
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 244 487 6.0E-20
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 277 471 1.0E-19
sp|Q43067|TCMO_PEA Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 278 473 1.0E-19
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 305 478 1.0E-19
sp|Q43054|TCMO_POPKI Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 278 473 2.0E-19
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 293 474 2.0E-19
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 88 475 2.0E-19
sp|O81928|TCMO_CICAR Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 278 473 2.0E-19
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 303 474 2.0E-19
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 45 502 2.0E-19
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 166 474 3.0E-19
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 155 478 3.0E-19
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 277 485 3.0E-19
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 290 475 3.0E-19
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 78 474 4.0E-19
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 187 481 4.0E-19
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 303 474 4.0E-19
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 303 474 4.0E-19
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 100 504 7.0E-19
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 72 472 7.0E-19
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 262 472 8.0E-19
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 153 473 8.0E-19
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 183 490 8.0E-19
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 176 474 9.0E-19
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 62 478 9.0E-19
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 294 471 9.0E-19
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 124 473 1.0E-18
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 250 481 1.0E-18
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 250 481 1.0E-18
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 277 478 1.0E-18
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 265 492 1.0E-18
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 97 473 1.0E-18
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 251 474 2.0E-18
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 252 472 2.0E-18
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 277 472 2.0E-18
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 305 485 2.0E-18
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 137 474 3.0E-18
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 187 486 3.0E-18
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 250 474 3.0E-18
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 21 474 3.0E-18
sp|P37114|TCMO_MEDSA Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1 278 467 3.0E-18
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 303 471 3.0E-18
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 183 479 3.0E-18
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 31 471 3.0E-18
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 291 474 4.0E-18
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 277 475 4.0E-18
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 187 473 4.0E-18
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 303 473 4.0E-18
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 201 476 4.0E-18
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 250 475 4.0E-18
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 250 481 5.0E-18
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 299 480 5.0E-18
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 268 472 5.0E-18
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 248 471 5.0E-18
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 285 478 5.0E-18
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 283 481 6.0E-18
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 289 457 6.0E-18
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 266 475 6.0E-18
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 108 478 6.0E-18
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 119 498 7.0E-18
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 109 479 7.0E-18
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 153 476 7.0E-18
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 153 476 7.0E-18
sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 253 499 7.0E-18
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 253 472 8.0E-18
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 126 493 8.0E-18
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 136 473 8.0E-18
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 272 475 9.0E-18
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 255 472 9.0E-18
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 254 472 1.0E-17
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 125 473 1.0E-17
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 303 474 1.0E-17
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 252 472 1.0E-17
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 112 471 1.0E-17
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 126 493 1.0E-17
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 248 464 1.0E-17
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 182 452 1.0E-17
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 303 474 1.0E-17
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 304 483 1.0E-17
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 288 460 1.0E-17
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 268 472 1.0E-17
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 253 475 1.0E-17
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 296 480 1.0E-17
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 256 471 2.0E-17
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 260 473 2.0E-17
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 305 487 2.0E-17
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 109 479 2.0E-17
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 260 487 2.0E-17
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 113 475 3.0E-17
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 303 471 3.0E-17
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 183 471 3.0E-17
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 305 485 3.0E-17
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 255 467 3.0E-17
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 252 471 4.0E-17
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 256 472 4.0E-17
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 252 472 4.0E-17
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 253 485 4.0E-17
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 260 475 4.0E-17
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 192 473 4.0E-17
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 303 507 4.0E-17
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 125 473 4.0E-17
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 214 474 4.0E-17
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 187 481 5.0E-17
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 249 474 5.0E-17
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 253 487 5.0E-17
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 153 484 5.0E-17
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 47 472 5.0E-17
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 277 473 6.0E-17
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 248 474 7.0E-17
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 252 472 7.0E-17
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 252 473 8.0E-17
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 299 472 8.0E-17
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 305 485 9.0E-17
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 97 480 9.0E-17
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 295 475 1.0E-16
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 277 475 1.0E-16
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 214 483 1.0E-16
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 107 474 1.0E-16
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 112 471 1.0E-16
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 248 473 1.0E-16
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 284 474 1.0E-16
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 254 472 1.0E-16
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 295 472 1.0E-16
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 187 473 1.0E-16
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 283 475 1.0E-16
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 253 466 1.0E-16
sp|Q9V4T3|C4AD1_DROME Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 46 473 2.0E-16
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 303 471 2.0E-16
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 299 480 2.0E-16
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 288 480 2.0E-16
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 250 475 2.0E-16
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 304 485 2.0E-16
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 214 483 2.0E-16
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 112 471 2.0E-16
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 253 452 2.0E-16
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 248 471 2.0E-16
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 279 480 2.0E-16
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 187 480 3.0E-16
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 266 485 3.0E-16
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 272 485 3.0E-16
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 277 485 3.0E-16
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 301 472 3.0E-16
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 42 480 3.0E-16
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 251 474 4.0E-16
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 295 475 4.0E-16
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 46 474 4.0E-16
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 254 484 4.0E-16
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 254 472 4.0E-16
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 277 488 4.0E-16
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 303 471 4.0E-16
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 296 492 4.0E-16
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 281 452 4.0E-16
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 42 480 4.0E-16
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 248 471 4.0E-16
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 249 463 5.0E-16
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 119 471 5.0E-16
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 96 473 5.0E-16
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 305 456 5.0E-16
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 73 482 6.0E-16
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 252 485 6.0E-16
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 42 480 6.0E-16
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 164 466 6.0E-16
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 301 472 6.0E-16
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 237 474 7.0E-16
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 288 460 9.0E-16
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 141 472 9.0E-16
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 277 473 9.0E-16
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 123 474 1.0E-15
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 42 480 1.0E-15
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 118 471 1.0E-15
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 252 460 1.0E-15
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 295 460 1.0E-15
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 261 475 1.0E-15
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 293 471 1.0E-15
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 260 473 1.0E-15
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 261 480 1.0E-15
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 112 474 1.0E-15
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 290 460 1.0E-15
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 154 460 1.0E-15
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 285 475 1.0E-15
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 305 472 1.0E-15
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 275 472 1.0E-15
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 249 473 1.0E-15
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 19 476 2.0E-15
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 252 472 2.0E-15
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 42 474 2.0E-15
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 281 473 2.0E-15
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 288 480 2.0E-15
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 251 480 2.0E-15
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 187 480 2.0E-15
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 281 473 2.0E-15
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 301 475 2.0E-15
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 290 473 2.0E-15
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 250 485 2.0E-15
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 302 474 2.0E-15
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 214 474 2.0E-15
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 277 471 2.0E-15
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 281 485 3.0E-15
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 305 472 3.0E-15
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 249 473 3.0E-15
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 281 471 3.0E-15
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 282 501 3.0E-15
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 288 460 3.0E-15
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 190 460 3.0E-15
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 295 475 3.0E-15
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 154 471 4.0E-15
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 292 475 4.0E-15
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 152 473 4.0E-15
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 152 473 4.0E-15
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 289 460 4.0E-15
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 248 460 4.0E-15
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 250 473 5.0E-15
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 299 473 5.0E-15
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 214 474 5.0E-15
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 113 475 5.0E-15
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 275 481 5.0E-15
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 136 487 5.0E-15
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 214 483 5.0E-15
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 253 463 5.0E-15
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 299 480 5.0E-15
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 281 480 5.0E-15
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 296 473 5.0E-15
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 246 460 6.0E-15
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 243 472 6.0E-15
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 308 478 6.0E-15
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 263 450 7.0E-15
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 278 473 7.0E-15
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 277 472 7.0E-15
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 215 475 7.0E-15
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 292 475 7.0E-15
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 251 485 7.0E-15
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 305 472 8.0E-15
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 290 459 8.0E-15
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 236 474 8.0E-15
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 252 473 9.0E-15
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 305 473 9.0E-15
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 64 475 9.0E-15
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 152 473 9.0E-15
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 109 473 1.0E-14
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 304 461 1.0E-14
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 281 475 1.0E-14
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 183 471 1.0E-14
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 163 473 1.0E-14
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 290 460 1.0E-14
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 249 450 1.0E-14
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 285 480 1.0E-14
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 288 475 1.0E-14
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 154 460 1.0E-14
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 285 471 2.0E-14
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 290 460 2.0E-14
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 293 471 2.0E-14
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 251 474 2.0E-14
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 265 495 2.0E-14
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 281 463 2.0E-14
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 277 471 2.0E-14
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 275 450 2.0E-14
sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 254 482 2.0E-14
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 263 450 2.0E-14
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 251 474 2.0E-14
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 277 471 2.0E-14
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 305 474 3.0E-14
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 188 468 3.0E-14
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 64 475 3.0E-14
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 250 483 3.0E-14
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 303 492 3.0E-14
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 143 474 3.0E-14
sp|Q9LNJ4|C70A2_ARATH Cytochrome P450 703A2 OS=Arabidopsis thaliana GN=CYP703A2 PE=2 SV=1 262 484 3.0E-14
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 265 495 3.0E-14
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 244 475 3.0E-14
sp|Q42602|C89A2_ARATH Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2 251 476 3.0E-14
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 303 471 4.0E-14
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 248 460 4.0E-14
sp|Q50LE0|C85A3_SOLLC Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 268 483 4.0E-14
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 241 479 4.0E-14
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 289 460 4.0E-14
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 164 493 4.0E-14
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 303 471 4.0E-14
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 249 471 4.0E-14
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 285 506 4.0E-14
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 164 480 5.0E-14
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 254 475 5.0E-14
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 248 460 5.0E-14
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 249 480 5.0E-14
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 305 498 5.0E-14
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 150 473 6.0E-14
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 303 474 6.0E-14
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 263 450 6.0E-14
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 278 473 6.0E-14
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 152 473 7.0E-14
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 277 471 7.0E-14
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 257 480 7.0E-14
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 260 460 7.0E-14
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 272 476 8.0E-14
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 248 460 9.0E-14
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 292 475 9.0E-14
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 289 460 9.0E-14
sp|Q1ZXL7|C5083_DICDI Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 291 471 9.0E-14
sp|Q54WB9|C513D_DICDI Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 281 501 1.0E-13
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 305 486 1.0E-13
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 305 473 1.0E-13
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 296 474 1.0E-13
sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 278 473 1.0E-13
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 303 471 1.0E-13
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 292 486 1.0E-13
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 279 486 1.0E-13
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 305 485 1.0E-13
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 254 472 1.0E-13
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 294 474 1.0E-13
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 281 473 1.0E-13
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 305 475 2.0E-13
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 260 473 2.0E-13
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 251 482 2.0E-13
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 126 489 2.0E-13
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 72 475 2.0E-13
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 277 472 2.0E-13
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 303 472 2.0E-13
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 279 471 2.0E-13
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 279 471 2.0E-13
sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 250 472 2.0E-13
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 303 472 2.0E-13
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 252 472 2.0E-13
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 281 471 2.0E-13
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 306 471 2.0E-13
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 257 472 3.0E-13
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 256 487 3.0E-13
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 305 471 3.0E-13
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 277 471 3.0E-13
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 277 473 4.0E-13
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 196 472 4.0E-13
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 271 475 4.0E-13
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 133 476 4.0E-13
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 281 460 4.0E-13
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 250 461 4.0E-13
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 305 475 4.0E-13
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 277 490 4.0E-13
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 277 490 4.0E-13
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 277 490 4.0E-13
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 305 475 5.0E-13
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 190 468 5.0E-13
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 289 460 5.0E-13
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 155 471 5.0E-13
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 265 473 6.0E-13
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 306 471 6.0E-13
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 277 473 6.0E-13
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 305 471 6.0E-13
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 281 473 6.0E-13
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 295 475 7.0E-13
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 295 475 7.0E-13
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 295 475 7.0E-13
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 306 472 7.0E-13
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 256 480 7.0E-13
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 281 473 7.0E-13
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 277 473 8.0E-13
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 285 493 8.0E-13
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 296 473 8.0E-13
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 296 473 8.0E-13
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 72 472 8.0E-13
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 260 473 9.0E-13
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 279 456 9.0E-13
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 305 473 9.0E-13
sp|H2KYS3|DAF9_CAEEL Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 277 471 9.0E-13
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 277 473 9.0E-13
sp|Q69F95|C85A_PHAVU Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 285 483 1.0E-12
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 285 493 1.0E-12
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 289 487 1.0E-12
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 251 485 1.0E-12
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 257 460 1.0E-12
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 150 473 1.0E-12
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 297 473 1.0E-12
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 248 460 1.0E-12
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 190 506 1.0E-12
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 248 493 1.0E-12
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 305 485 1.0E-12
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 285 496 1.0E-12
sp|P00186|CP1A2_MOUSE Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 285 453 2.0E-12
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 187 473 2.0E-12
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 92 471 2.0E-12
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 252 468 2.0E-12
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 260 473 2.0E-12
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 220 473 2.0E-12
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 285 471 2.0E-12
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 253 487 2.0E-12
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 266 476 2.0E-12
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 277 471 2.0E-12
sp|Q940V4|C85A2_ARATH Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1 254 482 2.0E-12
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 305 499 2.0E-12
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 284 460 2.0E-12
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 305 483 2.0E-12
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 125 473 2.0E-12
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 250 471 3.0E-12
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 275 472 3.0E-12
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 295 472 3.0E-12
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 305 480 3.0E-12
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 286 506 3.0E-12
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 268 474 3.0E-12
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 155 474 3.0E-12
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 248 463 4.0E-12
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 252 485 4.0E-12
sp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 252 475 4.0E-12
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 264 473 4.0E-12
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 261 460 4.0E-12
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 304 452 4.0E-12
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 286 506 5.0E-12
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 281 473 5.0E-12
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 295 475 5.0E-12
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 268 493 6.0E-12
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 255 461 6.0E-12
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 289 460 6.0E-12
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 297 475 6.0E-12
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 295 501 6.0E-12
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 266 476 6.0E-12
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 289 460 6.0E-12
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 291 474 7.0E-12
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 285 485 7.0E-12
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 285 485 7.0E-12
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 275 501 8.0E-12
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 305 483 8.0E-12
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 268 471 8.0E-12
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 305 474 1.0E-11
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 250 480 1.0E-11
sp|Q1ZXA1|C521A_DICDI Probable cytochrome P450 521A1 OS=Dictyostelium discoideum GN=cyp521A1 PE=3 SV=1 298 471 1.0E-11
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 305 471 1.0E-11
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 305 475 1.0E-11
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 237 474 1.0E-11
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 154 452 1.0E-11
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 277 473 1.0E-11
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 295 501 1.0E-11
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 289 471 1.0E-11
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 285 474 1.0E-11
sp|Q9VRB3|CP6V1_DROME Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 169 461 2.0E-11
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 261 471 2.0E-11
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 300 463 2.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 277 473 2.0E-11
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 304 499 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005506 iron ion binding Yes
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|313
MTFESQPLSPPSDGLSALITAGFFVGSLWILGSVAYALFLSPLRRIPGPPLARFTRLWELWALRQGRYNERLISL
HRQHGPVVRLAPNRFSFDRAADMKKIYSISGSFEKANFYHSWSDPKRENLLSIQDEKRHAQQRRPIAQLYTMTAV
LSYEEAVDKMSAVFTEKLGALVHSKETFALPRFCQLYAFDVIGQITMDTDFGMMESNGDTTGVLKTVERFTNYAV
QMGMVPELHRPVFALLMFIQPPFARVLTNVINSTIDKFRKRTRGGQSSFEPFLSKLLALEEKGKVDELSMMNVVG
ANINAGSDTTGVTLSATFYHLYRNPDKLRKLRDEIDAFARDGRASDPVTFAEAQAMPYLQAVVKEVLRMHPAVSV
ILPRTVPKGGVELGGHFFPAKAEVGCSAWPLHYNPQEVDRPREFRPERWLETEHEAASRSSQAVNFAFGAGSRTC
LGKNISLLEISKLVPQVVRSFDVQIHGASDSMETDAGWFVWPRYTCRVESRSQARSRDVGVEDM*
Coding >Hirsu2|313
ATGACGTTCGAGTCGCAGCCTCTTTCCCCGCCGTCGGACGGCCTCTCAGCGCTCATCACGGCCGGCTTCTTCGTC
GGATCGCTCTGGATCCTGGGCTCCGTTGCGTACGCTCTGTTCCTTTCGCCTCTGCGTCGAATCCCAGGCCCGCCT
CTGGCCAGATTTACGCGGCTCTGGGAGCTATGGGCCCTGCGCCAGGGCCGCTACAACGAGCGGCTCATCAGCCTC
CATCGGCAGCACGGACCCGTCGTGCGCCTGGCGCCGAACCGCTTCAGCTTCGATCGTGCTGCAGACATGAAAAAG
ATCTACTCCATCAGCGGCAGCTTCGAAAAGGCCAACTTCTACCACAGCTGGAGCGACCCCAAGCGGGAGAATCTG
CTCAGCATCCAGGACGAGAAGAGGCACGCGCAGCAGAGGCGGCCCATTGCCCAGCTCTACACCATGACGGCCGTG
CTGAGTTACGAGGAGGCCGTCGATAAGATGAGCGCCGTCTTTACCGAAAAGCTCGGGGCGCTCGTTCATTCGAAG
GAGACGTTCGCACTGCCTAGGTTCTGCCAGCTGTATGCCTTCGATGTGATCGGGCAGATCACGATGGATACCGAC
TTCGGCATGATGGAGAGCAACGGAGACACGACAGGCGTGTTGAAGACGGTCGAGCGCTTCACCAACTATGCCGTC
CAGATGGGCATGGTGCCCGAGCTGCACCGTCCCGTCTTTGCTCTCCTTATGTTCATCCAACCCCCGTTCGCACGC
GTATTGACCAACGTCATCAACAGCACCATCGACAAGTTCCGCAAGAGAACGCGTGGCGGGCAGTCGAGCTTCGAG
CCCTTCCTTTCGAAGCTTCTCGCGCTGGAAGAAAAGGGCAAGGTCGACGAGCTATCGATGATGAACGTCGTCGGC
GCCAACATCAACGCCGGCTCGGACACGACGGGGGTCACCCTCAGCGCCACCTTCTACCATCTCTACCGCAACCCG
GACAAGCTGCGCAAGCTACGGGACGAGATTGACGCCTTCGCCCGCGACGGCCGGGCCTCGGACCCCGTCACCTTC
GCCGAGGCACAGGCCATGCCGTATCTGCAGGCGGTCGTCAAGGAGGTGCTCCGGATGCACCCCGCCGTGAGCGTC
ATTCTGCCCAGGACGGTCCCCAAAGGCGGAGTCGAACTGGGTGGCCACTTCTTCCCTGCCAAGGCCGAAGTCGGC
TGCTCGGCTTGGCCGCTTCATTATAACCCTCAGGAAGTGGATCGACCGCGTGAGTTCCGGCCGGAGCGCTGGCTC
GAGACCGAACACGAGGCCGCGTCAAGAAGTAGCCAGGCTGTCAACTTTGCTTTCGGAGCCGGCTCGCGGACCTGC
CTCGGAAAAAACATAAGCCTGCTTGAGATCTCGAAACTCGTTCCGCAAGTCGTTCGAAGTTTCGATGTTCAGATC
CACGGTGCCTCGGACTCGATGGAGACAGATGCAGGCTGGTTCGTCTGGCCTCGGTATACGTGCCGGGTTGAGTCG
CGGTCCCAAGCTCGAAGCAGAGACGTGGGCGTCGAGGATATGTGA
Transcript >Hirsu2|313
ATGACGTTCGAGTCGCAGCCTCTTTCCCCGCCGTCGGACGGCCTCTCAGCGCTCATCACGGCCGGCTTCTTCGTC
GGATCGCTCTGGATCCTGGGCTCCGTTGCGTACGCTCTGTTCCTTTCGCCTCTGCGTCGAATCCCAGGCCCGCCT
CTGGCCAGATTTACGCGGCTCTGGGAGCTATGGGCCCTGCGCCAGGGCCGCTACAACGAGCGGCTCATCAGCCTC
CATCGGCAGCACGGACCCGTCGTGCGCCTGGCGCCGAACCGCTTCAGCTTCGATCGTGCTGCAGACATGAAAAAG
ATCTACTCCATCAGCGGCAGCTTCGAAAAGGCCAACTTCTACCACAGCTGGAGCGACCCCAAGCGGGAGAATCTG
CTCAGCATCCAGGACGAGAAGAGGCACGCGCAGCAGAGGCGGCCCATTGCCCAGCTCTACACCATGACGGCCGTG
CTGAGTTACGAGGAGGCCGTCGATAAGATGAGCGCCGTCTTTACCGAAAAGCTCGGGGCGCTCGTTCATTCGAAG
GAGACGTTCGCACTGCCTAGGTTCTGCCAGCTGTATGCCTTCGATGTGATCGGGCAGATCACGATGGATACCGAC
TTCGGCATGATGGAGAGCAACGGAGACACGACAGGCGTGTTGAAGACGGTCGAGCGCTTCACCAACTATGCCGTC
CAGATGGGCATGGTGCCCGAGCTGCACCGTCCCGTCTTTGCTCTCCTTATGTTCATCCAACCCCCGTTCGCACGC
GTATTGACCAACGTCATCAACAGCACCATCGACAAGTTCCGCAAGAGAACGCGTGGCGGGCAGTCGAGCTTCGAG
CCCTTCCTTTCGAAGCTTCTCGCGCTGGAAGAAAAGGGCAAGGTCGACGAGCTATCGATGATGAACGTCGTCGGC
GCCAACATCAACGCCGGCTCGGACACGACGGGGGTCACCCTCAGCGCCACCTTCTACCATCTCTACCGCAACCCG
GACAAGCTGCGCAAGCTACGGGACGAGATTGACGCCTTCGCCCGCGACGGCCGGGCCTCGGACCCCGTCACCTTC
GCCGAGGCACAGGCCATGCCGTATCTGCAGGCGGTCGTCAAGGAGGTGCTCCGGATGCACCCCGCCGTGAGCGTC
ATTCTGCCCAGGACGGTCCCCAAAGGCGGAGTCGAACTGGGTGGCCACTTCTTCCCTGCCAAGGCCGAAGTCGGC
TGCTCGGCTTGGCCGCTTCATTATAACCCTCAGGAAGTGGATCGACCGCGTGAGTTCCGGCCGGAGCGCTGGCTC
GAGACCGAACACGAGGCCGCGTCAAGAAGTAGCCAGGCTGTCAACTTTGCTTTCGGAGCCGGCTCGCGGACCTGC
CTCGGAAAAAACATAAGCCTGCTTGAGATCTCGAAACTCGTTCCGCAAGTCGTTCGAAGTTTCGATGTTCAGATC
CACGGTGCCTCGGACTCGATGGAGACAGATGCAGGCTGGTTCGTCTGGCCTCGGTATACGTGCCGGGTTGAGTCG
CGGTCCCAAGCTCGAAGCAGAGACGTGGGCGTCGAGGATATGTGA
Gene >Hirsu2|313
ATGACGTTCGAGTCGCAGCCTCTTTCCCCGCCGTCGGACGGCCTCTCAGCGCTCATCACGGCCGGCTTCTTCGTC
GGATCGCTCTGGATCCTGGGCTCCGTTGCGTACGCTCTGTTCCTTTCGCCTCTGCGTCGAATCCCAGGCCCGCCT
CTGGCCAGATTTACGCGGCTCTGGGAGCTATGGGCCCTGCGCCAGGGCCGCTACAACGAGCGGCTCATCAGCCTC
CATCGGCAGCACGGTGAGCCCTTTCAGACAGGCAGCGCTCTCACGCATGGCATGCTCGACAATTCATGACCTGTT
CTACCGCGATCCGCCCATCTCCGTGCTCCCTGTCCGTTTCCGCTGAAGCCGCGCCCCTGACTACCTGGCGTAGGA
CCCGTCGTGCGCCTGGCGCCGAACCGCTTCAGCTTCGATCGTGCTGCAGACATGAAAAAGATCTACTCCATCAGC
GGCAGCTTCGAAAAGGCCAACTTCTACCACAGCTGGAGCGACCCCAAGCGGGAGAATCTGCTCAGCATCCAGGAC
GAGAAGAGGCACGCGCAGCAGAGGCGGCCCATTGCCCAGCTCTACACCATGACGGCCGTGCTGAGTTACGAGGAG
GCCGTCGATAAGATGAGCGCCGTCTTTACCGAAAAGCTCGGGGCGCTCGTTCATTCGAAGGAGACGTTCGCACTG
CCTAGGTTCTGCCAGCTGTATGCCTTCGATGTGATCGGGCAGATCACGGTTCGCCTCCCCGCCTGGTCGATTTCC
GCTCCGTACACGGGCACCAACCCAGAAAGAACCCCTCGACATATGGAACTTCCGAAGCTTCCACGCTGACCTGCA
TGACCGTCCTCTCCCTAGATGGATACCGACTTCGGCATGATGGAGAGCAACGGAGACACGACAGGCGTGTTGAAG
ACGGTCGAGCGCTTCACCAACTATGCCGTCCAGATGGGCATGGTGCCCGAGCTGCACCGTCCCGTCTTTGCTCTC
CTTATGTTCATCCAACCCCCGTTCGCACGCGTATTGACCAACGTCATCAACAGCACCATCGACAAGTTCCGCAAG
AGAACGCGTGGCGGGCAGTCGAGCTTCGAGCCCTTCCTTTCGAAGCTTCTCGCGCTGGAAGAAAAGGGCAAGGTC
GACGAGCTATCGATGATGAACGTCGTCGGCGCCAACATCAACGCCGGCTCGGACACGACGGGGGTCACCCTCAGC
GCCACCTTCTACCATCTCTACCGCAACCCGGACAAGCTGCGCAAGCTACGGGACGAGATTGACGCCTTCGCCCGC
GACGGCCGGGCCTCGGACCCCGTCACCTTCGCCGAGGCACAGGCCATGCCGTATCTGCAGGCGGTCGTCAAGGAG
GTGCTCCGGATGCACCCCGCCGTGAGCGTCATTCTGCCCAGGACGGTCCCCAAAGGCGGAGTCGAACTGGGTGGC
CACTTCTTCCCTGCCAAGGTGATCCTCCAGAGATTGAACCCCCCGAATGTTGTCGCTCCGCTGGGGTTCCCTGTG
GTGTATCTTGTCTGCGGCTGACTGAAGCTTGTCTAGGCCGAAGTCGGCTGCTCGGCTTGGCCGCTTCATTATAAC
CCTCAGGAAGTGGATCGACCGCGTGAGTTCCGGCCGGAGCGCTGGCTCGAGACCGAACACGAGGCCGCGTCAAGA
AGTAGCCAGGCTGTCAACTTTGCTGTAAGTGCAGACTGTGTCCCGTTTCCTCCCAATTGTCCTCGCGCGTCTCCG
CCGGACGCCGGCAATGACCATATAATTCGGAGTCCTGGCCAATCGGGAACGCTGAGAATCGGATACATCACAGTT
CGGAGCCGGCTCGCGGACCTGCCTCGGAAAAAACATAAGCCTGCTTGAGATCTCGAAACTCGTTCCGCAAGTCGT
TCGAAGTTTCGATGTTCAGATCCACGGTGCCTCGGACTCGATGGAGACAGATGCAGGCTGGTTCGTCTGGCCTCG
GTATACGTGCCGGGTTGAGTCGCGGTCCCAAGCTCGAAGCAGAGACGTGGGCGTCGAGGATATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail