Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3128
Gene name
LocationContig_18:29986..31885
Strand+
Gene length (bp)1899
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.4E-20 127 265
PF08031 BBE Berberine and berberine like 4.2E-11 524 572

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 23 588 5.0E-65
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 575 6.0E-53
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 132 566 1.0E-13
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 68 290 1.0E-08
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 127 290 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 23 588 5.0E-65
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 575 6.0E-53
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 132 566 1.0E-13
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 68 290 1.0E-08
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 127 290 3.0E-08
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 130 306 2.0E-07
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 127 290 3.0E-07
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 98 290 5.0E-07
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 138 566 5.0E-06
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 130 295 8.0E-06
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 127 290 9.0E-06
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 132 309 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3128
MRPLEFAVPLLLLLLPCVAQSACKPVPGDSNWPPRRVWKQLNQTVGGRLMATVPLGSVCHPGGYGPRRPEPINET
ACGILRDQWPFPPVFSASPADVMNAYFQNASCSPFYDTNGRCRLGNLASYSIAVSEAQHVIAGVQFARDNNVRLA
IKNTGHDFMGKSTGKGSLSLWMHNLNRREIIHNYTSSAYSGAALRMGAGTTGDQALSFATAAGYVLVTGDCPTVG
VAVGYASGGGHGLLNNVHGMGADNVLEWEVVTADGRHLTASPDQNADLYWALTGGGAGTFAVVLSVTYRLHPDVS
VGAATLSFSRDFAPSKQAYENAVQAWWLFLPTVVDAGAAPAFNLMPDQFLVHNTTGPNMTAAAMNALYAPYLAQL
DQLGVSYDFATYTSPNFLEHFNATNGPLPDGPYTASPLFNSRIIPLTVSQDASRARNLTLAMMAVMDYDPSGANW
QFGCQGVNVGDKNKRFTHPDNALAAYWRNAIAICLEYSLYDWDLPQSEMLRRKQDLANIIHPPIVAATIDSGSYL
NEADPLVYPMDQPSKWKDAFYGANYNRLRSVKDKWDPQSVFYARTSVGSEDWTQDSEGRLCKA*
Coding >Hirsu2|3128
ATGCGGCCTCTCGAGTTCGCTGTGCCGCTGCTATTACTGCTGCTACCATGCGTCGCCCAGTCCGCCTGCAAGCCC
GTCCCGGGCGACAGCAACTGGCCGCCCCGGCGGGTCTGGAAGCAGCTCAATCAGACGGTTGGCGGCCGCCTGATG
GCCACTGTTCCCTTGGGCTCCGTCTGCCATCCGGGAGGATACGGGCCCAGGCGGCCCGAGCCGATCAACGAGACC
GCATGTGGTATTCTGAGGGACCAATGGCCCTTTCCACCTGTCTTCTCGGCATCTCCGGCCGACGTCATGAACGCC
TACTTCCAGAACGCGTCCTGCAGCCCCTTCTACGATACCAACGGCCGCTGCCGGCTCGGCAACCTCGCCAGCTAC
TCCATCGCCGTCTCGGAGGCCCAGCATGTCATCGCCGGCGTCCAGTTTGCTCGGGACAACAACGTCCGGCTGGCG
ATCAAGAACACGGGCCATGACTTTATGGGCAAGTCGACCGGCAAGGGAAGCCTCTCTCTCTGGATGCACAACCTG
AACAGGAGGGAGATAATCCACAACTACACCAGCTCGGCCTACAGCGGAGCAGCCCTGCGTATGGGCGCCGGCACC
ACGGGTGACCAGGCGCTTAGCTTTGCGACAGCTGCTGGCTACGTCCTCGTGACCGGTGACTGTCCGACCGTTGGT
GTGGCTGTCGGTTATGCCTCGGGCGGCGGCCATGGCCTGCTCAACAACGTGCACGGCATGGGGGCCGACAACGTA
CTCGAGTGGGAGGTCGTCACGGCCGACGGCCGCCACCTTACGGCCAGCCCGGACCAGAACGCCGATCTTTACTGG
GCCCTCACCGGCGGCGGCGCCGGCACGTTCGCCGTTGTCCTCTCCGTCACCTACCGGCTGCATCCCGACGTCAGC
GTCGGAGCCGCCACGCTCAGTTTCAGCAGGGACTTTGCCCCGAGCAAGCAGGCATACGAGAACGCCGTCCAGGCT
TGGTGGCTCTTCCTGCCGACCGTCGTCGATGCCGGCGCTGCCCCAGCCTTCAACCTCATGCCCGACCAGTTTCTC
GTTCACAACACGACCGGTCCCAACATGACGGCTGCCGCCATGAACGCTCTGTATGCGCCCTATCTGGCCCAGCTC
GACCAGCTGGGCGTCTCGTATGACTTCGCCACGTACACGTCGCCCAACTTCTTGGAGCATTTCAACGCCACCAAC
GGCCCCCTACCCGACGGCCCATACACGGCCTCCCCCCTCTTCAACAGTAGAATCATACCGCTCACCGTCTCCCAA
GATGCCTCCAGGGCCCGGAACCTGACGCTCGCCATGATGGCTGTCATGGATTACGATCCATCCGGAGCCAACTGG
CAGTTCGGGTGTCAGGGTGTGAATGTTGGCGATAAGAACAAGCGCTTCACGCATCCCGATAATGCCCTTGCCGCC
TATTGGCGCAACGCCATCGCCATCTGCCTTGAATATTCACTTTACGACTGGGATCTACCCCAGTCGGAGATGCTC
CGCCGCAAGCAAGACCTGGCCAACATCATCCATCCACCCATTGTGGCCGCCACGATCGACTCGGGCTCATACCTA
AACGAGGCCGATCCGTTGGTATACCCGATGGATCAGCCCTCAAAGTGGAAAGATGCCTTCTATGGGGCCAACTAC
AATCGTCTACGGAGCGTGAAGGATAAGTGGGATCCCCAGTCGGTCTTTTACGCTCGCACCAGCGTCGGGTCAGAA
GACTGGACCCAAGACTCGGAGGGAAGGTTGTGCAAAGCTTGA
Transcript >Hirsu2|3128
ATGCGGCCTCTCGAGTTCGCTGTGCCGCTGCTATTACTGCTGCTACCATGCGTCGCCCAGTCCGCCTGCAAGCCC
GTCCCGGGCGACAGCAACTGGCCGCCCCGGCGGGTCTGGAAGCAGCTCAATCAGACGGTTGGCGGCCGCCTGATG
GCCACTGTTCCCTTGGGCTCCGTCTGCCATCCGGGAGGATACGGGCCCAGGCGGCCCGAGCCGATCAACGAGACC
GCATGTGGTATTCTGAGGGACCAATGGCCCTTTCCACCTGTCTTCTCGGCATCTCCGGCCGACGTCATGAACGCC
TACTTCCAGAACGCGTCCTGCAGCCCCTTCTACGATACCAACGGCCGCTGCCGGCTCGGCAACCTCGCCAGCTAC
TCCATCGCCGTCTCGGAGGCCCAGCATGTCATCGCCGGCGTCCAGTTTGCTCGGGACAACAACGTCCGGCTGGCG
ATCAAGAACACGGGCCATGACTTTATGGGCAAGTCGACCGGCAAGGGAAGCCTCTCTCTCTGGATGCACAACCTG
AACAGGAGGGAGATAATCCACAACTACACCAGCTCGGCCTACAGCGGAGCAGCCCTGCGTATGGGCGCCGGCACC
ACGGGTGACCAGGCGCTTAGCTTTGCGACAGCTGCTGGCTACGTCCTCGTGACCGGTGACTGTCCGACCGTTGGT
GTGGCTGTCGGTTATGCCTCGGGCGGCGGCCATGGCCTGCTCAACAACGTGCACGGCATGGGGGCCGACAACGTA
CTCGAGTGGGAGGTCGTCACGGCCGACGGCCGCCACCTTACGGCCAGCCCGGACCAGAACGCCGATCTTTACTGG
GCCCTCACCGGCGGCGGCGCCGGCACGTTCGCCGTTGTCCTCTCCGTCACCTACCGGCTGCATCCCGACGTCAGC
GTCGGAGCCGCCACGCTCAGTTTCAGCAGGGACTTTGCCCCGAGCAAGCAGGCATACGAGAACGCCGTCCAGGCT
TGGTGGCTCTTCCTGCCGACCGTCGTCGATGCCGGCGCTGCCCCAGCCTTCAACCTCATGCCCGACCAGTTTCTC
GTTCACAACACGACCGGTCCCAACATGACGGCTGCCGCCATGAACGCTCTGTATGCGCCCTATCTGGCCCAGCTC
GACCAGCTGGGCGTCTCGTATGACTTCGCCACGTACACGTCGCCCAACTTCTTGGAGCATTTCAACGCCACCAAC
GGCCCCCTACCCGACGGCCCATACACGGCCTCCCCCCTCTTCAACAGTAGAATCATACCGCTCACCGTCTCCCAA
GATGCCTCCAGGGCCCGGAACCTGACGCTCGCCATGATGGCTGTCATGGATTACGATCCATCCGGAGCCAACTGG
CAGTTCGGGTGTCAGGGTGTGAATGTTGGCGATAAGAACAAGCGCTTCACGCATCCCGATAATGCCCTTGCCGCC
TATTGGCGCAACGCCATCGCCATCTGCCTTGAATATTCACTTTACGACTGGGATCTACCCCAGTCGGAGATGCTC
CGCCGCAAGCAAGACCTGGCCAACATCATCCATCCACCCATTGTGGCCGCCACGATCGACTCGGGCTCATACCTA
AACGAGGCCGATCCGTTGGTATACCCGATGGATCAGCCCTCAAAGTGGAAAGATGCCTTCTATGGGGCCAACTAC
AATCGTCTACGGAGCGTGAAGGATAAGTGGGATCCCCAGTCGGTCTTTTACGCTCGCACCAGCGTCGGGTCAGAA
GACTGGACCCAAGACTCGGAGGGAAGGTTGTGCAAAGCTTGA
Gene >Hirsu2|3128
ATGCGGCCTCTCGAGTTCGCTGTGCCGCTGCTATTACTGCTGCTACCATGCGTCGCCCAGTCCGCCTGCAAGCCC
GTCCCGGGCGACAGCAACTGGCCGCCCCGGCGGGTCTGGAAGCAGCTCAATCAGACGGTTGGCGGCCGCCTGATG
GCCACTGTTCCCTTGGGCTCCGTCTGCCATCCGGGAGGATACGGGCCCAGGCGGCCCGAGCCGATCAACGAGACC
GCATGTGGTATTCTGAGGGACCAATGGCCCTTTCCACCTGTCTTGTACGTTTTTCGGTCTCCTGTGGCGAGTATG
GTTCAGTGGCTAACTCTAGCTGACTCGGGCCGCACAGCTCGGCATCTCCGGCCGACGTCATGAACGCCTACTTCC
AGAACGCGTCCTGCAGCCCCTTCTACGATACCAACGGCCGCTGCCGGCTCGGCAACCTCGCCAGCTACTCCATCG
CCGTCTCGGAGGCCCAGCATGTCATCGCCGGCGTCCAGTTTGCTCGGGACAACAACGTCCGGCTGGCGATCAAGA
ACACGGGCCATGAGTGCGTCTTCCCTCCCATGTCGTCGAGATGGAAGGGGGGCGTATACTAAAATCAAGACCTCC
AGCTTTATGGGCAAGTCGACCGGCAAGGGAAGCCTCTCTCTCTGGATGCACAACCTGAACAGGAGGGAGATAATC
CACAACTACACCAGCTCGGCCTACAGCGGAGCAGCCCTGCGTATGGGCGCCGGCACCACGGGTGACCAGGCGCTT
AGCTTTGCGACAGCTGCTGGCTACGTCCTCGTGACCGGTGACTGTCCGACCGTTGGTGTGGCTGTCGGTTATGCC
TCGGGCGGCGGCCATGGCCTGCTCAACAACGTGCACGGCATGGGGGCCGACAACGTACTCGAGTGGGAGGTCGTC
ACGGCCGACGGCCGCCACCTTACGGCCAGCCCGGACCAGAACGCCGATCTTTACTGGGCCCTCACCGGCGGCGGC
GCCGGCACGTTCGCCGTTGTCCTCTCCGTCACCTACCGGCTGCATCCCGACGTCAGCGTCGGAGCCGCCACGCTC
AGTTTCAGCAGGGACTTTGCCCCGAGCAAGCAGGCATACGAGAACGCCGTCCAGGCTTGGTGGCTCTTCCTGCCG
ACCGTCGTCGATGCCGGCGCTGCCCCAGCCTTCAACCTCATGCCCGACCAGTTTCTCGTTCACAACACGACCGGT
CCCAACATGACGGCTGCCGCCATGAACGCTCTGTATGCGCCCTATCTGGCCCAGCTCGACCAGCTGGGCGTCTCG
TATGACTTCGCCACGTACACGTCGCCCAACTTCTTGGAGCATTTCAACGCCACCAACGGCCCCCTACCCGACGGC
CCATACACGGCCTCCCCCCTCTTCAACAGTAGAATCATACCGCTCACCGTCTCCCAAGATGCCTCCAGGGCCCGG
AACCTGACGCTCGCCATGATGGCTGTCATGGATTACGATCCATCCGGAGCCAACTGGCAGTTCGGGTGTCAGGGT
GTGAATGTTGGCGATAAGAACAAGCGCTTCACGCATCCCGATAATGCCCTTGCCGCCTATTGGCGCAACGCCATC
GCCATCTGCCTTGAATATTCACTTTACGACTGGGATCTACCCCAGTCGGAGATGCTCCGCCGCAAGCAAGACCTG
GCCAACATCATCCATCCACCCATTGTGGCCGCCACGATCGACTCGGGCTCATACCTAAACGAGGCCGATCCGTTG
GTATACCCGATGGATCAGCCCTCAAAGTGGAAAGATGCCTTCTATGGGGCCAACTACAATCGTCTACGGAGCGTG
AAGGATAAGTGGGATCCCCAGTCGGTCTTTTACGCTCGCACCAGCGTCGGGTCAGAAGACTGGACCCAAGACTCG
GAGGGAAGGTTGTGCAAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail