Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3125
Gene name
LocationContig_18:24596..25747
Strand-
Gene length (bp)1151
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.7E-08 121 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 12 302 4.0E-40
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 9 236 2.0E-25
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 9 194 2.0E-10
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 9 302 1.0E-08
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 11 184 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 12 302 4.0E-40
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 9 236 2.0E-25
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 9 194 2.0E-10
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 9 302 1.0E-08
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 11 184 8.0E-07
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 36 184 1.0E-06
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 11 192 4.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7206 0.4399 0.3914 0.0505 0.16 0.056 0.083 0.0592 0.2006 0.0027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|710
Ophiocordyceps kimflemingae Ophio5|5516
Ophiocordyceps subramaniannii Hirsu2|3125 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3125
MLTHFFMDGNTVGCDFCGIVDEAGPSSVHPPGVRVCGADFPYRPGNPYNGAFAQYAVVDSRHALRVPDGMSDVQA
AALGAIGWGTAALAIADTGALNLPGLPSSPAVEPIPVLVYGGATATGIMAIQMLKLSGYVPIAVCSPQSAPLVMS
HGAAGTTSYTSATPADDIKKIAGGRPIKHALDCITDAESASTCFAVLARVGGRYACLEAIPDAWVTRRAVKIKVV
MGFEGQNFDVELGHPVYSRKANPALHAIVTGWAKELQSLLHKRQITTQPIQEVGGGFEGAIKALEMSHKAVLYGN
RLSM*
Coding >Hirsu2|3125
ATGCTAACACACTTCTTCATGGACGGCAACACGGTTGGTTGCGATTTCTGCGGCATCGTCGACGAGGCCGGGCCA
TCGTCCGTCCATCCCCCGGGGGTTCGGGTCTGCGGCGCCGACTTCCCGTATCGCCCAGGCAACCCATACAACGGC
GCGTTCGCCCAGTATGCCGTCGTCGACTCGCGCCATGCGCTTCGGGTACCAGACGGCATGAGCGACGTCCAGGCG
GCCGCCCTCGGGGCCATCGGCTGGGGCACCGCGGCCCTTGCCATAGCGGACACGGGGGCGTTGAATCTCCCGGGG
CTGCCCTCCAGCCCGGCTGTGGAGCCCATTCCCGTGCTGGTCTATGGCGGCGCGACCGCTACTGGAATCATGGCC
ATCCAGATGTTGAAGCTCTCTGGCTACGTGCCCATTGCCGTATGCTCGCCTCAGTCGGCCCCCTTGGTCATGAGC
CATGGGGCGGCAGGGACGACTTCTTACACCTCGGCGACCCCCGCAGACGACATCAAGAAGATAGCCGGCGGGAGA
CCGATCAAGCACGCGCTCGACTGCATCACCGATGCCGAGTCGGCTTCGACCTGCTTCGCCGTGCTGGCTCGGGTG
GGAGGACGCTATGCCTGTCTGGAAGCGATACCCGACGCTTGGGTCACGAGACGTGCTGTCAAGATAAAGGTGGTG
ATGGGCTTCGAAGGACAGAACTTCGACGTCGAACTCGGGCACCCGGTCTACTCGCGCAAGGCAAATCCCGCTTTG
CACGCCATCGTCACCGGCTGGGCCAAGGAGTTGCAGTCGTTACTGCACAAGAGACAAATCACGACACAGCCGATC
CAAGAGGTCGGTGGCGGGTTTGAGGGGGCCATAAAGGCGCTGGAAATGTCGCACAAGGCGGTGCTGTATGGCAAC
AGGCTCTCCATGTGA
Transcript >Hirsu2|3125
ATGCTAACACACTTCTTCATGGACGGCAACACGGTTGGTTGCGATTTCTGCGGCATCGTCGACGAGGCCGGGCCA
TCGTCCGTCCATCCCCCGGGGGTTCGGGTCTGCGGCGCCGACTTCCCGTATCGCCCAGGCAACCCATACAACGGC
GCGTTCGCCCAGTATGCCGTCGTCGACTCGCGCCATGCGCTTCGGGTACCAGACGGCATGAGCGACGTCCAGGCG
GCCGCCCTCGGGGCCATCGGCTGGGGCACCGCGGCCCTTGCCATAGCGGACACGGGGGCGTTGAATCTCCCGGGG
CTGCCCTCCAGCCCGGCTGTGGAGCCCATTCCCGTGCTGGTCTATGGCGGCGCGACCGCTACTGGAATCATGGCC
ATCCAGATGTTGAAGCTCTCTGGCTACGTGCCCATTGCCGTATGCTCGCCTCAGTCGGCCCCCTTGGTCATGAGC
CATGGGGCGGCAGGGACGACTTCTTACACCTCGGCGACCCCCGCAGACGACATCAAGAAGATAGCCGGCGGGAGA
CCGATCAAGCACGCGCTCGACTGCATCACCGATGCCGAGTCGGCTTCGACCTGCTTCGCCGTGCTGGCTCGGGTG
GGAGGACGCTATGCCTGTCTGGAAGCGATACCCGACGCTTGGGTCACGAGACGTGCTGTCAAGATAAAGGTGGTG
ATGGGCTTCGAAGGACAGAACTTCGACGTCGAACTCGGGCACCCGGTCTACTCGCGCAAGGCAAATCCCGCTTTG
CACGCCATCGTCACCGGCTGGGCCAAGGAGTTGCAGTCGTTACTGCACAAGAGACAAATCACGACACAGCCGATC
CAAGAGGTCGGTGGCGGGTTTGAGGGGGCCATAAAGGCGCTGGAAATGTCGCACAAGGCGGTGCTGTATGGCAAC
AGGCTCTCCATGTGA
Gene >Hirsu2|3125
ATGCTAACACACTTCTTCATGGACGGCAACACGGTTGGTTGCGATTTCTGCGGCATCGTCGACGAGGCCGGGCCA
TCGTCCGTCCATCCCCCGGGGGTTCGGGTCTGCGGCGCCGACTTCCCGTATCGCCCAGGCAACCCATACAACGGC
GCGTTCGCCCAGTATGCCGTCGTCGACTCGCGCCATGCGCTTCGGGTACCAGACGGCATGAGCGACGTCCAGGCG
GCCGCCCTCGGGGCCATCGGCTGGGGCACCGCGGCCCTTGCCATAGCGGACACGGGGGCGTTGAATCTCCCGGGG
CTGCCCTCCAGCCCGGCTGTGGAGCCCATTCCCGTGCTGGTCTATGGCGGCGCGACCGCTACTGGAATCATGGCC
ATCCAGATGTTGAAGCTGTCAGTGATTCCTAACCCTACGCCTCCAGGCCTTGCAATGCCGTCATCGGCACAAGGC
GTCGTCCGCAGTCTGAACTGACTATGTAAACCCCCTCGCCGGATAGCTCTGGCTACGTGCCCATTGCCGTATGCT
CGCCTCAGTCGGCCCCCTTGGTCATGAGCCATGGGGCGGCAGGGACGACTTCTTACACCTCGGCGACCCCCGCAG
ACGACATCAAGAAGATAGCCGGCGGGAGACCGATCAAGCACGCGCTCGACTGCATCACCGATGCCGAGTCGGCTT
CGACCTGCTTCGCCGTGCTGGCTCGGGTGGGAGGACGCTATGCCTGTCTGGAAGCGATACCCGACGCTTGGGTCA
CGAGACGTGCTGTCAAGATAAAGGTGGTGATGGGCTTCGAAGGACAGAACTTCGACGTCGAACTCGGGCACCCGG
TCTACTCGCGCAAGGCAAATCCCGCTTTGCACGCCATCGTCACCGGCTGGGCCAAGGAGTTGCAGTCGTTACTGC
ACAAGAGACAAATCACGACACAGCCGATCCAAGAGGTCGGTGGCGGGTTTGAGGGGGCCATAAAGGCGCTGGAAA
TGTCGCACAAGGGTGAGGCCAGGGGCAGAAAGCTGGTTGTAAGGCTACATGTACCAACAGGCGAGATGTGTTCTT
GACGACTCGATCTGTTCTAAGTGCGCAAAAGAAACAAGATCTTCATTCGTCACACCACTGCCAGTGCAGCGGTGC
TGTATGGCAACAGGCTCTCCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail