Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3122
Gene name
LocationContig_18:13765..15988
Strand-
Gene length (bp)2223
Transcript length (bp)2223
Coding sequence length (bp)2223
Protein length (aa) 741

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 8.3E-43 323 631
PF00698 Acyl_transf_1 Acyl transferase domain 3.5E-28 4 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 733 2.0E-154
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 728 2.0E-121
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 728 1.0E-118
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2 568 1.0E-98
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 637 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 733 2.0E-154
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 728 2.0E-121
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 728 1.0E-118
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2 568 1.0E-98
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 637 1.0E-45
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 16 362 3.0E-20
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 2 370 1.0E-19
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 2 374 4.0E-19
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 14 565 2.0E-18
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 14 565 2.0E-18
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 14 565 2.0E-18
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 3 372 3.0E-18
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 16 306 1.0E-17
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 2 222 1.0E-17
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2 222 1.0E-17
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 14 553 2.0E-16
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2 222 4.0E-16
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 16 306 1.0E-15
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 11 369 6.0E-15
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 16 376 1.0E-14
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 14 376 6.0E-13
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 14 375 6.0E-13
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 11 370 8.0E-13
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2 376 1.0E-12
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 2 559 2.0E-12
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 16 374 3.0E-12
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 7 306 3.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 16 374 5.0E-12
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 15 369 6.0E-12
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 16 239 1.0E-11
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 7 230 1.0E-11
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 5 371 1.0E-11
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 2 559 2.0E-11
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 16 374 4.0E-11
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 11 369 6.0E-11
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 11 369 7.0E-11
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 16 374 2.0E-10
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 16 374 3.0E-10
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 5 380 6.0E-10
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 15 369 7.0E-10
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 5 380 8.0E-10
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 5 380 8.0E-10
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 5 380 8.0E-10
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 5 380 8.0E-10
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 14 369 2.0E-09
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 11 369 2.0E-09
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 11 368 3.0E-09
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 14 369 3.0E-09
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 14 369 3.0E-09
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 11 222 6.0E-09
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 15 233 2.0E-08
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 11 369 4.0E-08
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 16 220 8.0E-08
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 2 238 1.0E-07
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 308 1.0E-07
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 308 1.0E-07
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 16 228 2.0E-07
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 308 2.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 14 222 4.0E-07
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 14 224 4.0E-07
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 11 369 2.0E-06
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 6 230 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3122
MMVDVLAAANIRFDIVVGHSSGEIAAAYAAGYLSARDTILVAYFRGLHCKEAASPNGEEIRGAMLAAGTCLEDAK
ELCQSEEFDGRVVVAASNSPDSVTFSGDEDAIEELAIILEDEKKFHRRLRVDQAYHSGHMLPCAEPYAQSLRRAG
VKAQQRDLGRPPCTWFSSVHGGRPVDAAHDALGDEYWAQNMTQPVLFFEALSAAISTAPLAAAVEVGPHPSLAGP
AEQTIQQTLKEKLPYRGCLSRKTDARQGLAACLAFLWELLDPAAGVPALRQCQDAVDGREHPRAVLKSLPPYPWK
HDARYWQESRRSRCMRLRDEPFHPLLGNMVPDSATHALRWSNVLKASEMPWLEGHRVQGQIVFPAAGYVATAVEA
ARFLVPGPQRDGIRIIELSRFSIHNAIALDADDAGIEVHVELARVAATTSGCITACFSYSAALGAHLELAAGGEV
KVWLGEGALDLLPRRLPSPPHVIPVEPDRLYGFLASLEYSFSGPFRSLESIERKLGRASCVARKANAPSTASEKL
LIHPAELDAAFQSVMLAYSYPGDDRLRLLHLPTSIETVRVNPAVLTSSGYVEDDYHDLCSTSHAPVEHAEPGAGF
SGDVSLYTSSARESGAAVQVKQIRFKPVGSGASYDRNVFYKMRWLPAKPDGKRAADKVPVTKQDEELRWVLSRIA
TFYLRQFDEIVPPDSLARQQSPNCHYLNYARHMTDLLRRGEHRWAREEWLNDSLQNVMDDIKAKR*
Coding >Hirsu2|3122
ATGATGGTCGACGTGCTTGCCGCGGCGAATATCAGGTTTGACATCGTTGTCGGCCATTCGAGCGGCGAAATTGCA
GCCGCCTATGCGGCCGGGTATCTCAGTGCTCGCGATACCATTCTCGTGGCCTACTTCCGGGGACTTCACTGTAAA
GAGGCAGCAAGTCCGAACGGGGAAGAGATCCGGGGAGCCATGTTAGCGGCAGGAACATGTCTCGAAGACGCCAAA
GAGCTGTGCCAGTCGGAAGAATTTGATGGCCGTGTGGTGGTGGCTGCGAGCAACTCGCCGGACAGCGTAACATTC
TCGGGAGACGAGGATGCCATCGAAGAGCTGGCCATCATTCTCGAAGACGAGAAGAAGTTCCATCGTCGGCTGCGG
GTCGACCAAGCCTATCACTCCGGACACATGTTGCCATGCGCGGAGCCCTACGCGCAGTCGTTAAGACGAGCCGGC
GTCAAGGCGCAGCAGCGAGACCTCGGCCGACCGCCATGCACCTGGTTCTCAAGCGTTCACGGCGGCAGGCCCGTC
GATGCGGCACACGATGCGCTCGGGGACGAGTACTGGGCGCAAAATATGACACAGCCGGTGCTCTTCTTCGAGGCT
CTGAGCGCCGCCATATCCACAGCGCCACTCGCCGCCGCCGTCGAGGTCGGGCCTCATCCGTCCCTGGCAGGCCCG
GCCGAACAGACGATACAGCAGACGCTCAAGGAGAAGCTGCCATACCGCGGTTGTCTGTCACGGAAGACAGATGCC
CGTCAGGGGCTGGCTGCGTGCCTGGCCTTTCTTTGGGAGCTGCTTGATCCAGCAGCGGGCGTGCCGGCCCTTCGA
CAATGCCAAGACGCGGTCGACGGGCGCGAGCATCCGCGCGCGGTGCTGAAGAGCCTGCCGCCATATCCGTGGAAA
CACGACGCCCGATACTGGCAGGAGTCAAGGCGGTCGCGCTGCATGCGGCTCCGAGACGAGCCCTTCCATCCACTG
CTGGGAAACATGGTGCCCGACAGCGCCACGCACGCGCTGCGGTGGTCCAACGTGCTCAAGGCTAGCGAGATGCCC
TGGCTCGAGGGTCACAGGGTGCAAGGCCAGATCGTCTTTCCGGCCGCAGGCTATGTGGCGACGGCGGTCGAGGCG
GCGCGCTTCCTGGTCCCAGGACCGCAGCGAGACGGCATCCGCATCATCGAGCTGAGCCGCTTCAGCATCCATAAT
GCCATCGCCCTGGACGCCGACGACGCGGGAATCGAGGTTCACGTTGAGCTTGCCCGAGTCGCTGCAACAACGTCT
GGCTGCATCACGGCTTGCTTCAGCTATTCAGCTGCGCTGGGAGCTCATCTCGAGCTGGCGGCCGGTGGCGAGGTC
AAGGTCTGGCTGGGCGAGGGGGCGCTCGACCTCCTTCCGCGCCGCCTGCCATCGCCGCCTCACGTGATCCCCGTC
GAGCCAGACCGCCTTTATGGCTTCCTGGCGAGTCTCGAGTACAGCTTCTCAGGTCCCTTCCGCTCTTTGGAGTCG
ATCGAGCGCAAGCTCGGCCGCGCATCGTGCGTCGCCCGCAAGGCGAACGCACCGTCAACAGCGTCCGAAAAGTTG
CTCATCCATCCCGCCGAGCTGGATGCCGCCTTCCAGTCGGTCATGCTTGCGTACAGCTACCCTGGCGATGACCGC
CTGCGCCTCCTGCATCTGCCCACGAGCATCGAGACGGTTCGAGTCAACCCTGCCGTGCTGACATCGTCTGGCTAT
GTCGAGGACGACTACCACGACCTGTGCTCTACGTCACACGCCCCAGTGGAGCACGCCGAGCCCGGGGCCGGCTTC
TCGGGCGATGTCAGCCTGTACACGTCATCCGCTCGGGAGTCAGGCGCCGCAGTTCAGGTCAAGCAGATCAGATTT
AAGCCCGTGGGTTCCGGTGCCAGCTACGACAGGAACGTCTTCTATAAAATGCGCTGGCTGCCGGCCAAGCCGGAT
GGGAAGAGGGCTGCGGACAAGGTGCCCGTGACGAAACAGGACGAGGAGCTCCGATGGGTACTGTCCCGCATTGCC
ACTTTCTACCTTAGGCAATTCGACGAGATCGTCCCTCCCGACTCTTTAGCAAGGCAGCAGAGTCCCAACTGCCAT
TATCTCAACTATGCGCGGCACATGACCGATCTGCTGAGGCGCGGAGAGCATCGGTGGGCACGGGAGGAGTGGCTG
AACGACAGTCTCCAGAACGTCATGGATGATATCAAGGCGAAGAGGTGA
Transcript >Hirsu2|3122
ATGATGGTCGACGTGCTTGCCGCGGCGAATATCAGGTTTGACATCGTTGTCGGCCATTCGAGCGGCGAAATTGCA
GCCGCCTATGCGGCCGGGTATCTCAGTGCTCGCGATACCATTCTCGTGGCCTACTTCCGGGGACTTCACTGTAAA
GAGGCAGCAAGTCCGAACGGGGAAGAGATCCGGGGAGCCATGTTAGCGGCAGGAACATGTCTCGAAGACGCCAAA
GAGCTGTGCCAGTCGGAAGAATTTGATGGCCGTGTGGTGGTGGCTGCGAGCAACTCGCCGGACAGCGTAACATTC
TCGGGAGACGAGGATGCCATCGAAGAGCTGGCCATCATTCTCGAAGACGAGAAGAAGTTCCATCGTCGGCTGCGG
GTCGACCAAGCCTATCACTCCGGACACATGTTGCCATGCGCGGAGCCCTACGCGCAGTCGTTAAGACGAGCCGGC
GTCAAGGCGCAGCAGCGAGACCTCGGCCGACCGCCATGCACCTGGTTCTCAAGCGTTCACGGCGGCAGGCCCGTC
GATGCGGCACACGATGCGCTCGGGGACGAGTACTGGGCGCAAAATATGACACAGCCGGTGCTCTTCTTCGAGGCT
CTGAGCGCCGCCATATCCACAGCGCCACTCGCCGCCGCCGTCGAGGTCGGGCCTCATCCGTCCCTGGCAGGCCCG
GCCGAACAGACGATACAGCAGACGCTCAAGGAGAAGCTGCCATACCGCGGTTGTCTGTCACGGAAGACAGATGCC
CGTCAGGGGCTGGCTGCGTGCCTGGCCTTTCTTTGGGAGCTGCTTGATCCAGCAGCGGGCGTGCCGGCCCTTCGA
CAATGCCAAGACGCGGTCGACGGGCGCGAGCATCCGCGCGCGGTGCTGAAGAGCCTGCCGCCATATCCGTGGAAA
CACGACGCCCGATACTGGCAGGAGTCAAGGCGGTCGCGCTGCATGCGGCTCCGAGACGAGCCCTTCCATCCACTG
CTGGGAAACATGGTGCCCGACAGCGCCACGCACGCGCTGCGGTGGTCCAACGTGCTCAAGGCTAGCGAGATGCCC
TGGCTCGAGGGTCACAGGGTGCAAGGCCAGATCGTCTTTCCGGCCGCAGGCTATGTGGCGACGGCGGTCGAGGCG
GCGCGCTTCCTGGTCCCAGGACCGCAGCGAGACGGCATCCGCATCATCGAGCTGAGCCGCTTCAGCATCCATAAT
GCCATCGCCCTGGACGCCGACGACGCGGGAATCGAGGTTCACGTTGAGCTTGCCCGAGTCGCTGCAACAACGTCT
GGCTGCATCACGGCTTGCTTCAGCTATTCAGCTGCGCTGGGAGCTCATCTCGAGCTGGCGGCCGGTGGCGAGGTC
AAGGTCTGGCTGGGCGAGGGGGCGCTCGACCTCCTTCCGCGCCGCCTGCCATCGCCGCCTCACGTGATCCCCGTC
GAGCCAGACCGCCTTTATGGCTTCCTGGCGAGTCTCGAGTACAGCTTCTCAGGTCCCTTCCGCTCTTTGGAGTCG
ATCGAGCGCAAGCTCGGCCGCGCATCGTGCGTCGCCCGCAAGGCGAACGCACCGTCAACAGCGTCCGAAAAGTTG
CTCATCCATCCCGCCGAGCTGGATGCCGCCTTCCAGTCGGTCATGCTTGCGTACAGCTACCCTGGCGATGACCGC
CTGCGCCTCCTGCATCTGCCCACGAGCATCGAGACGGTTCGAGTCAACCCTGCCGTGCTGACATCGTCTGGCTAT
GTCGAGGACGACTACCACGACCTGTGCTCTACGTCACACGCCCCAGTGGAGCACGCCGAGCCCGGGGCCGGCTTC
TCGGGCGATGTCAGCCTGTACACGTCATCCGCTCGGGAGTCAGGCGCCGCAGTTCAGGTCAAGCAGATCAGATTT
AAGCCCGTGGGTTCCGGTGCCAGCTACGACAGGAACGTCTTCTATAAAATGCGCTGGCTGCCGGCCAAGCCGGAT
GGGAAGAGGGCTGCGGACAAGGTGCCCGTGACGAAACAGGACGAGGAGCTCCGATGGGTACTGTCCCGCATTGCC
ACTTTCTACCTTAGGCAATTCGACGAGATCGTCCCTCCCGACTCTTTAGCAAGGCAGCAGAGTCCCAACTGCCAT
TATCTCAACTATGCGCGGCACATGACCGATCTGCTGAGGCGCGGAGAGCATCGGTGGGCACGGGAGGAGTGGCTG
AACGACAGTCTCCAGAACGTCATGGATGATATCAAGGCGAAGAGGTGA
Gene >Hirsu2|3122
ATGATGGTCGACGTGCTTGCCGCGGCGAATATCAGGTTTGACATCGTTGTCGGCCATTCGAGCGGCGAAATTGCA
GCCGCCTATGCGGCCGGGTATCTCAGTGCTCGCGATACCATTCTCGTGGCCTACTTCCGGGGACTTCACTGTAAA
GAGGCAGCAAGTCCGAACGGGGAAGAGATCCGGGGAGCCATGTTAGCGGCAGGAACATGTCTCGAAGACGCCAAA
GAGCTGTGCCAGTCGGAAGAATTTGATGGCCGTGTGGTGGTGGCTGCGAGCAACTCGCCGGACAGCGTAACATTC
TCGGGAGACGAGGATGCCATCGAAGAGCTGGCCATCATTCTCGAAGACGAGAAGAAGTTCCATCGTCGGCTGCGG
GTCGACCAAGCCTATCACTCCGGACACATGTTGCCATGCGCGGAGCCCTACGCGCAGTCGTTAAGACGAGCCGGC
GTCAAGGCGCAGCAGCGAGACCTCGGCCGACCGCCATGCACCTGGTTCTCAAGCGTTCACGGCGGCAGGCCCGTC
GATGCGGCACACGATGCGCTCGGGGACGAGTACTGGGCGCAAAATATGACACAGCCGGTGCTCTTCTTCGAGGCT
CTGAGCGCCGCCATATCCACAGCGCCACTCGCCGCCGCCGTCGAGGTCGGGCCTCATCCGTCCCTGGCAGGCCCG
GCCGAACAGACGATACAGCAGACGCTCAAGGAGAAGCTGCCATACCGCGGTTGTCTGTCACGGAAGACAGATGCC
CGTCAGGGGCTGGCTGCGTGCCTGGCCTTTCTTTGGGAGCTGCTTGATCCAGCAGCGGGCGTGCCGGCCCTTCGA
CAATGCCAAGACGCGGTCGACGGGCGCGAGCATCCGCGCGCGGTGCTGAAGAGCCTGCCGCCATATCCGTGGAAA
CACGACGCCCGATACTGGCAGGAGTCAAGGCGGTCGCGCTGCATGCGGCTCCGAGACGAGCCCTTCCATCCACTG
CTGGGAAACATGGTGCCCGACAGCGCCACGCACGCGCTGCGGTGGTCCAACGTGCTCAAGGCTAGCGAGATGCCC
TGGCTCGAGGGTCACAGGGTGCAAGGCCAGATCGTCTTTCCGGCCGCAGGCTATGTGGCGACGGCGGTCGAGGCG
GCGCGCTTCCTGGTCCCAGGACCGCAGCGAGACGGCATCCGCATCATCGAGCTGAGCCGCTTCAGCATCCATAAT
GCCATCGCCCTGGACGCCGACGACGCGGGAATCGAGGTTCACGTTGAGCTTGCCCGAGTCGCTGCAACAACGTCT
GGCTGCATCACGGCTTGCTTCAGCTATTCAGCTGCGCTGGGAGCTCATCTCGAGCTGGCGGCCGGTGGCGAGGTC
AAGGTCTGGCTGGGCGAGGGGGCGCTCGACCTCCTTCCGCGCCGCCTGCCATCGCCGCCTCACGTGATCCCCGTC
GAGCCAGACCGCCTTTATGGCTTCCTGGCGAGTCTCGAGTACAGCTTCTCAGGTCCCTTCCGCTCTTTGGAGTCG
ATCGAGCGCAAGCTCGGCCGCGCATCGTGCGTCGCCCGCAAGGCGAACGCACCGTCAACAGCGTCCGAAAAGTTG
CTCATCCATCCCGCCGAGCTGGATGCCGCCTTCCAGTCGGTCATGCTTGCGTACAGCTACCCTGGCGATGACCGC
CTGCGCCTCCTGCATCTGCCCACGAGCATCGAGACGGTTCGAGTCAACCCTGCCGTGCTGACATCGTCTGGCTAT
GTCGAGGACGACTACCACGACCTGTGCTCTACGTCACACGCCCCAGTGGAGCACGCCGAGCCCGGGGCCGGCTTC
TCGGGCGATGTCAGCCTGTACACGTCATCCGCTCGGGAGTCAGGCGCCGCAGTTCAGGTCAAGCAGATCAGATTT
AAGCCCGTGGGTTCCGGTGCCAGCTACGACAGGAACGTCTTCTATAAAATGCGCTGGCTGCCGGCCAAGCCGGAT
GGGAAGAGGGCTGCGGACAAGGTGCCCGTGACGAAACAGGACGAGGAGCTCCGATGGGTACTGTCCCGCATTGCC
ACTTTCTACCTTAGGCAATTCGACGAGATCGTCCCTCCCGACTCTTTAGCAAGGCAGCAGAGTCCCAACTGCCAT
TATCTCAACTATGCGCGGCACATGACCGATCTGCTGAGGCGCGGAGAGCATCGGTGGGCACGGGAGGAGTGGCTG
AACGACAGTCTCCAGAACGTCATGGATGATATCAAGGCGAAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail