Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3121
Gene name
LocationContig_18:12043..13646
Strand-
Gene length (bp)1603
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08242 Methyltransf_12 Methyltransferase domain 1.2E-20 55 156
PF13489 Methyltransf_23 Methyltransferase domain 2.9E-14 39 212
PF13649 Methyltransf_25 Methyltransferase domain 2.9E-13 55 154
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-11 55 158
PF13847 Methyltransf_31 Methyltransferase domain 3.4E-08 50 162
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.7E-05 33 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 478 4.0E-94
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 464 3.0E-72
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 464 3.0E-72
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 17 462 6.0E-47
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 377 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 478 4.0E-94
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 464 3.0E-72
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 464 3.0E-72
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 17 462 6.0E-47
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 377 1.0E-41
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 19 217 9.0E-13
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 69 212 1.0E-12
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 52 219 2.0E-12
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 19 217 2.0E-12
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 42 209 2.0E-11
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 20 204 2.0E-10
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 18 193 2.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 18 193 2.0E-09
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 18 193 5.0E-09
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 18 193 2.0E-08
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 18 209 3.0E-08
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 19 216 3.0E-08
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 18 193 3.0E-08
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 18 193 7.0E-08
sp|C0Z787|BIOC_BREBN Malonyl-[acyl-carrier protein] O-methyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=bioC PE=3 SV=1 32 213 2.0E-07
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 18 214 2.0E-07
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 18 182 9.0E-07
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 18 209 1.0E-06
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 21 209 1.0E-06
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 18 376 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3121
MPRVFRGETTMLEHFRISGLLDEYYANGYGTKQTVIWVADLVKQLTDRNPHLNLLEIGAGTGGATKSILRAVGYD
FSSYTFTDISSSFFENAAEAFAQWGDSVVFKTYNAEIDPLQQGFQAGAYDVVIAFMVIHACARLDEAMRNLRKLL
KPGGLLILGEGAAGGAMQAGAGFIFGPLPGWWRGVDEGRTLSPLVDVSDWESILKRTGFSGIDTMSPSSLFDVFG
ITLIVSTAVDQRVDFIRNPVPAATAMGLRYKTVVILGGTSPPVARLVKTLAGILAPLSETVLNYDSLESMDGQSL
VDPNTVVVSLTDLEQAVFQDITPERWYKFRCLFETERAILWLTRGRLEDNPFCNMTVGFGRSAVHEQENLRLQFL
DVPDVSKVDARTIADTLLRFANESLYGQDILYTKEPEMLIDVEGCERVPRLFPVTEANDRINSVERPIFHQVDIL
DSVVELQRGQESCNLRALSRYETSQSLAPRCVSW*
Coding >Hirsu2|3121
ATGCCCCGGGTTTTCAGGGGCGAGACGACCATGCTGGAACATTTCCGCATATCTGGTCTGTTGGACGAGTACTAT
GCCAATGGCTACGGCACCAAGCAAACTGTTATATGGGTTGCCGACCTGGTCAAGCAACTGACTGACCGAAACCCT
CACCTAAATTTACTGGAGATTGGTGCCGGTACCGGTGGCGCCACAAAGAGCATTTTGCGTGCCGTGGGCTACGAC
TTTTCAAGCTATACTTTCACAGATATCTCATCCAGTTTCTTCGAGAACGCCGCTGAAGCGTTCGCTCAGTGGGGA
GACAGCGTCGTCTTTAAGACTTACAATGCCGAGATTGATCCCCTGCAGCAGGGATTTCAGGCAGGCGCGTATGAC
GTCGTCATCGCTTTCATGGTAATCCACGCCTGCGCTCGGCTGGATGAAGCCATGCGCAATCTTCGCAAGCTCCTC
AAGCCCGGTGGTCTTTTGATCCTAGGGGAGGGAGCGGCTGGCGGCGCGATGCAGGCTGGTGCTGGCTTCATCTTT
GGTCCTTTGCCAGGCTGGTGGCGAGGCGTGGACGAGGGTCGGACCCTGTCCCCCCTGGTGGACGTCTCCGACTGG
GAATCCATCCTCAAGAGAACCGGTTTTTCGGGCATCGACACCATGTCACCCTCCAGTCTCTTTGATGTTTTTGGT
ATTACGCTCATCGTCTCCACGGCGGTAGACCAGCGCGTTGACTTCATCCGAAATCCCGTCCCTGCCGCCACCGCC
ATGGGCCTCAGATACAAGACGGTTGTCATCTTGGGAGGCACGAGCCCACCTGTGGCGCGTCTGGTCAAGACGCTG
GCCGGAATACTCGCCCCACTTTCCGAGACTGTTTTGAATTACGACAGTCTCGAGAGCATGGATGGACAAAGTCTT
GTTGACCCGAATACCGTAGTCGTGTCCCTAACAGATCTCGAGCAAGCTGTGTTCCAGGACATCACGCCCGAGAGG
TGGTACAAGTTCAGATGCCTCTTCGAGACGGAGAGGGCGATCCTATGGCTCACCAGGGGCCGTCTTGAGGATAAC
CCATTCTGTAATATGACTGTCGGTTTTGGGCGTTCGGCGGTGCACGAGCAAGAGAACCTTCGCCTCCAATTTCTC
GACGTGCCGGATGTCAGCAAGGTGGATGCACGCACAATCGCCGACACGCTTCTCCGCTTCGCCAACGAGAGCTTA
TATGGCCAAGACATTCTCTACACGAAGGAGCCGGAGATGCTGATAGACGTGGAAGGTTGCGAGCGCGTACCACGA
CTGTTTCCTGTCACAGAAGCCAATGACCGTATCAACTCCGTCGAGCGGCCCATATTCCACCAGGTCGACATCCTT
GATTCCGTGGTCGAGCTTCAGCGAGGTCAGGAGAGTTGCAATCTAAGAGCACTCTCTCGGTACGAAACGTCGCAA
AGCTTAGCGCCGCGATGCGTCTCATGGTAA
Transcript >Hirsu2|3121
ATGCCCCGGGTTTTCAGGGGCGAGACGACCATGCTGGAACATTTCCGCATATCTGGTCTGTTGGACGAGTACTAT
GCCAATGGCTACGGCACCAAGCAAACTGTTATATGGGTTGCCGACCTGGTCAAGCAACTGACTGACCGAAACCCT
CACCTAAATTTACTGGAGATTGGTGCCGGTACCGGTGGCGCCACAAAGAGCATTTTGCGTGCCGTGGGCTACGAC
TTTTCAAGCTATACTTTCACAGATATCTCATCCAGTTTCTTCGAGAACGCCGCTGAAGCGTTCGCTCAGTGGGGA
GACAGCGTCGTCTTTAAGACTTACAATGCCGAGATTGATCCCCTGCAGCAGGGATTTCAGGCAGGCGCGTATGAC
GTCGTCATCGCTTTCATGGTAATCCACGCCTGCGCTCGGCTGGATGAAGCCATGCGCAATCTTCGCAAGCTCCTC
AAGCCCGGTGGTCTTTTGATCCTAGGGGAGGGAGCGGCTGGCGGCGCGATGCAGGCTGGTGCTGGCTTCATCTTT
GGTCCTTTGCCAGGCTGGTGGCGAGGCGTGGACGAGGGTCGGACCCTGTCCCCCCTGGTGGACGTCTCCGACTGG
GAATCCATCCTCAAGAGAACCGGTTTTTCGGGCATCGACACCATGTCACCCTCCAGTCTCTTTGATGTTTTTGGT
ATTACGCTCATCGTCTCCACGGCGGTAGACCAGCGCGTTGACTTCATCCGAAATCCCGTCCCTGCCGCCACCGCC
ATGGGCCTCAGATACAAGACGGTTGTCATCTTGGGAGGCACGAGCCCACCTGTGGCGCGTCTGGTCAAGACGCTG
GCCGGAATACTCGCCCCACTTTCCGAGACTGTTTTGAATTACGACAGTCTCGAGAGCATGGATGGACAAAGTCTT
GTTGACCCGAATACCGTAGTCGTGTCCCTAACAGATCTCGAGCAAGCTGTGTTCCAGGACATCACGCCCGAGAGG
TGGTACAAGTTCAGATGCCTCTTCGAGACGGAGAGGGCGATCCTATGGCTCACCAGGGGCCGTCTTGAGGATAAC
CCATTCTGTAATATGACTGTCGGTTTTGGGCGTTCGGCGGTGCACGAGCAAGAGAACCTTCGCCTCCAATTTCTC
GACGTGCCGGATGTCAGCAAGGTGGATGCACGCACAATCGCCGACACGCTTCTCCGCTTCGCCAACGAGAGCTTA
TATGGCCAAGACATTCTCTACACGAAGGAGCCGGAGATGCTGATAGACGTGGAAGGTTGCGAGCGCGTACCACGA
CTGTTTCCTGTCACAGAAGCCAATGACCGTATCAACTCCGTCGAGCGGCCCATATTCCACCAGGTCGACATCCTT
GATTCCGTGGTCGAGCTTCAGCGAGGTCAGGAGAGTTGCAATCTAAGAGCACTCTCTCGGTACGAAACGTCGCAA
AGCTTAGCGCCGCGATGCGTCTCATGGTAA
Gene >Hirsu2|3121
ATGCCCCGGGTTTTCAGGGGCGAGACGACCATGCTGGAACATTTCCGCATATCTGGTCTGTTGGACGAGTACTAT
GCCAATGGCTACGGCACCAAGCAAACTGTATGGCCTCAGACGTAGTCGAGTGGTCTGCCCATGGATAGGCTAAGA
CTAAGTGTACAACAGGTTATATGGGTTGCCGACCTGGTCAAGCAACTGACTGACCGAAACCCTCACCTAAATTTA
CTGGAGATTGGTGCGTCCAGCCATTCTTTCGGAGCTTACTGGACCTTCGGGATTTCTGACAGAAGTTTTCGATGC
TGACGGCTCAATCCTTCTAGGTGCCGGTACCGGTGGCGCCACAAAGAGCATTTTGCGTGCCGTGGGCTACGACTT
TTCAAGCTATACTTTCACAGATATCTCATCCAGTTTCTTCGAGAACGCCGCTGAAGCGTTCGCTCAGTGGGGAGA
CAGCGTCGTCTTTAAGACTTACAATGCCGAGATTGATCCCCTGCAGCAGGGATTTCAGGCAGGCGCGTATGACGT
CGTCATCGCTTTCATGGTAATCCACGCCTGCGCTCGGCTGGATGAAGCCATGCGCAATCTTCGCAAGCTCCTCAA
GCCCGGTGGTCTTTTGATCCTAGGGGAGGGAGCGGCTGGCGGCGCGATGCAGGCTGGTGCTGGCTTCATCTTTGG
TCCTTTGCCAGGCTGGTGGCGAGGCGTGGACGAGGGTCGGACCCTGTCCCCCCTGGTGGACGTCTCCGACTGGGA
ATCCATCCTCAAGAGAACCGGTTTTTCGGGCATCGACACCATGTCACCCTCCAGTCTCTTTGATGTTTTTGGTAT
TACGCTCATCGTCTCCACGGCGGTAGACCAGCGCGTTGACTTCATCCGAAATCCCGTCCCTGCCGCCACCGCCAT
GGGCCTCAGATACAAGACGGTTGTCATCTTGGGAGGCACGAGCCCACCTGTGGCGCGTCTGGTCAAGACGCTGGC
CGGAATACTCGCCCCACTTTCCGAGACTGTTTTGAATTACGACAGTCTCGAGAGCATGGATGGACAAAGTCTTGT
TGACCCGAATACCGTAGTCGTGTCCCTAACAGATCTCGAGCAAGCTGTGTTCCAGGACATCACGCCCGAGAGGTG
GTACAAGTTCAGATGCCTCTTCGAGACGGAGAGGGCGATCCTATGGCTCACCAGGGGCCGTCTTGAGGATAACCC
ATTCTGTAATATGACTGTCGGTTTTGGGCGTTCGGCGGTGCACGAGCAAGAGAACCTTCGCCTCCAATTTCTCGA
CGTGCCGGATGTCAGCAAGGTGGATGCACGCACAATCGCCGACACGCTTCTCCGCTTCGCCAACGAGAGCTTATA
TGGCCAAGACATTCTCTACACGAAGGAGCCGGAGATGCTGATAGACGTGGAAGGTTGCGAGCGCGTACCACGACT
GTTTCCTGTCACAGAAGCCAATGACCGTATCAACTCCGTCGAGCGGCCCATATTCCACCAGGTCGACATCCTTGA
TTCCGTGGTCGAGCTTCAGCGAGGTCAGGAGAGTTGCAATCTAAGAGCACTCTCTCGGTACGAAACGTCGCAAAG
CTTAGCGCCGCGATGCGTCTCATGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail