Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3120
Gene name
LocationContig_18:8703..11402
Strand-
Gene length (bp)2699
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 2.8E-46 78 251
PF07993 NAD_binding_4 Male sterility protein 4.8E-33 525 757
PF01370 Epimerase NAD dependent epimerase/dehydratase family 9.8E-13 523 715
PF00106 adh_short short chain dehydrogenase 8.0E-13 81 252
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.9E-07 524 649

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 50 516 1.0E-83
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 9 470 8.0E-63
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 50 488 4.0E-59
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 50 488 1.0E-57
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 490 843 5.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 50 516 1.0E-83
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 9 470 8.0E-63
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 50 488 4.0E-59
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 50 488 1.0E-57
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 490 843 5.0E-53
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 492 821 1.0E-51
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 66 421 2.0E-35
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 75 420 2.0E-24
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 95 294 1.0E-22
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 56 294 2.0E-22
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 75 294 3.0E-22
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 75 308 2.0E-21
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 75 416 3.0E-21
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 75 416 6.0E-21
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 77 277 1.0E-19
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 76 416 2.0E-18
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 73 256 6.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 62 416 2.0E-16
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 72 436 2.0E-16
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 72 436 2.0E-16
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 56 255 2.0E-16
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 56 255 2.0E-16
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 56 255 2.0E-16
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 516 768 8.0E-16
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 92 421 1.0E-15
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 74 423 1.0E-15
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 165 743 1.0E-14
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 72 240 8.0E-14
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 95 416 1.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 95 421 2.0E-12
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 62 236 7.0E-12
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 519 721 1.0E-11
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 521 723 1.0E-11
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 134 743 1.0E-11
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 76 423 1.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 73 238 2.0E-11
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 68 258 2.0E-11
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 185 705 4.0E-11
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 64 264 6.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 73 236 6.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 165 781 1.0E-10
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 64 264 2.0E-10
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 64 264 2.0E-10
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 68 257 2.0E-10
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 68 257 2.0E-10
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 68 257 2.0E-10
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 68 257 2.0E-10
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 68 257 3.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 73 238 3.0E-10
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 165 707 4.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 60 225 5.0E-10
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 95 311 9.0E-10
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 95 311 9.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 522 721 1.0E-09
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 95 311 1.0E-09
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 392 708 3.0E-09
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 56 240 5.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2 229 7.0E-08
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 509 721 9.0E-08
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 146 260 2.0E-07
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 503 743 2.0E-07
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 518 708 3.0E-07
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 76 251 3.0E-07
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 76 248 6.0E-07
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 93 225 6.0E-07
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 392 758 8.0E-07
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 135 232 3.0E-06
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 71 255 4.0E-06
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 135 268 5.0E-06
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 77 251 9.0E-06
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 77 251 9.0E-06
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 77 232 1.0E-05
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 77 232 1.0E-05
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 77 232 1.0E-05
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 133 273 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0006629 lipid metabolic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3120
MASPAPLVKEQLERALSYIRSVEADCVFDSESVNLETLTAGKLPENPWIIVNWNSVPATLPVRVERLENQQLFKS
DKTYWLVGLSGALGISLCDWMIDRGVKHLVLTSRNPKIDTRWIDDHRRDGVTIEILCCDVTDEEAIKAVHQTIVE
KLPPIAGLLNGAMVLRDISVRNMEFEHVMDVIRPKVLGSIHLDRIFHDIDLDFFVLLSSINCVIGNVGQANYAAA
NMGMIGVAGNRRKRGLRSSVVNVGAIIGVGYITQSARQLDVTVAKTAMMHLSEQDFHQIFAECMEAGNLDNPAGP
EISTGLLDIMPETIDVPPWYFDPKFARFILNRTDKNDEKEQANTTSTQDRLLACRSDEDVVQVVQKAFAAQLRRI
LQISTTDDDLLSMRGGELGLDSLVSVDIRTWFLKNLQVSIPVLKIMANDVQMSELVDLACEGIPAELVPGARVQP
SSVDSSGQSAASSSAVASPAVTPLTSSESMTLPGEKGIDALVDWETECQPPEPEVCFHLSPQSQKPKPKPRVVVV
TGCSGLLGHHLLKTLVDQASIQKIVCVAVRRLSERLKSNQIPPPSDRIVYFEGDLGLPRFGLDPDQWTELFSEAD
AVIHNGSDTSHLKYYSALRRTNVESTRQLISACLPRMTPIHYVSSAGVALFAGLDAFPEISCTGTEKQPPLDGAH
GYMCGKWVCENLLERVHEKYGLQVVIQRPSTIIREGQDADTERAEFDWVNALLHYSHKIRAVPKVEHNSGVFDLV
SPQTCCSDIARELLRGSFGGIKYVNNVGDVIIPMDRMAELGLATVGEPYQVLAMKDWTSQAIEAGMHPAVGALVE
ALDDAGVERYPALLRQEHNT*
Coding >Hirsu2|3120
ATGGCTTCCCCTGCTCCTCTGGTCAAGGAACAGCTCGAGCGAGCACTAAGCTACATCCGCAGCGTTGAAGCTGAC
TGCGTCTTCGACTCCGAGTCCGTCAATTTGGAAACTCTCACCGCTGGAAAGCTGCCCGAAAACCCCTGGATCATT
GTCAATTGGAATTCCGTGCCCGCGACCCTCCCGGTCAGGGTTGAAAGACTCGAAAACCAGCAGCTCTTCAAGAGT
GATAAGACGTACTGGCTGGTCGGACTATCAGGTGCCCTAGGGATATCGCTGTGTGACTGGATGATTGATCGGGGC
GTCAAACATCTTGTTCTTACCAGTAGAAACCCAAAGATCGATACTCGCTGGATCGACGACCACAGGAGGGATGGT
GTCACCATCGAGATTTTGTGCTGTGACGTGACAGATGAAGAGGCCATTAAAGCTGTCCATCAGACAATAGTGGAA
AAGCTCCCGCCCATTGCTGGGCTTCTCAACGGCGCAATGGTGCTCCGCGATATCTCTGTGCGCAATATGGAATTC
GAGCATGTAATGGACGTTATTCGACCAAAGGTTCTGGGCAGCATCCACCTGGATCGCATCTTTCACGACATTGAT
CTCGACTTTTTCGTGCTGCTGTCTTCGATCAACTGCGTGATCGGCAACGTTGGCCAGGCAAACTATGCCGCAGCT
AACATGGGCATGATTGGCGTCGCTGGAAATCGTAGAAAGCGCGGCCTCCGGTCGTCGGTGGTCAATGTCGGGGCC
ATCATCGGGGTTGGATATATCACCCAGTCGGCGCGCCAACTCGATGTGACAGTTGCAAAGACAGCCATGATGCAT
TTGTCGGAACAAGACTTTCACCAGATCTTTGCGGAGTGCATGGAAGCTGGCAATCTCGATAATCCAGCCGGACCC
GAGATCTCGACGGGGCTGCTCGACATCATGCCGGAGACCATCGACGTGCCTCCGTGGTATTTTGATCCAAAATTT
GCCCGCTTCATTCTCAATCGTACCGATAAAAATGATGAAAAGGAGCAAGCAAACACGACAAGCACTCAAGACCGC
CTTCTGGCATGTCGATCAGACGAGGATGTGGTTCAAGTTGTCCAGAAGGCCTTTGCCGCTCAATTGCGCAGAATC
TTGCAAATATCCACGACTGACGACGACTTGTTGAGCATGCGCGGCGGAGAGCTTGGTCTGGACTCACTCGTCTCC
GTTGACATTCGCACTTGGTTTCTGAAGAATCTCCAGGTCAGCATTCCTGTGCTGAAGATCATGGCGAACGACGTG
CAAATGTCGGAACTGGTCGACCTGGCCTGCGAGGGGATTCCCGCCGAGTTAGTTCCAGGGGCTCGGGTCCAGCCC
TCTTCTGTCGATAGTAGCGGACAAAGCGCGGCATCGTCGTCCGCTGTGGCCTCGCCAGCCGTGACGCCTCTTACC
AGCTCGGAGAGCATGACGCTGCCTGGGGAGAAAGGCATTGACGCCTTGGTAGACTGGGAGACAGAGTGTCAGCCG
CCGGAGCCAGAAGTCTGTTTTCACCTTTCTCCACAATCCCAAAAGCCCAAGCCGAAACCTCGTGTGGTGGTCGTC
ACGGGCTGCAGCGGGCTTCTGGGTCACCACCTGCTCAAAACGCTGGTGGACCAGGCGTCTATCCAGAAGATCGTC
TGTGTTGCCGTTCGCCGCCTCTCGGAGCGGCTCAAGTCGAATCAGATTCCACCCCCCAGCGACAGGATCGTGTAT
TTCGAGGGTGACCTCGGCCTTCCCCGGTTCGGTCTCGATCCAGATCAATGGACCGAGTTGTTCAGCGAGGCCGAC
GCTGTTATTCACAACGGCTCCGACACATCGCATCTCAAGTACTATTCAGCCCTGCGTCGGACCAATGTGGAATCC
ACAAGGCAGCTGATTAGCGCATGTCTACCGCGCATGACGCCAATCCACTATGTGTCTTCAGCGGGCGTTGCGTTG
TTCGCCGGGCTCGACGCTTTCCCCGAAATATCATGCACCGGCACAGAGAAACAGCCGCCGCTGGATGGCGCGCAC
GGTTACATGTGCGGGAAATGGGTCTGTGAGAACCTCCTTGAGCGGGTCCATGAGAAATACGGACTGCAGGTTGTC
ATACAGCGGCCGTCCACTATCATTCGTGAGGGCCAAGATGCCGACACGGAACGAGCCGAATTCGACTGGGTGAAC
GCTCTGCTTCATTACTCGCACAAGATCAGAGCGGTGCCCAAGGTCGAGCACAACAGCGGCGTATTCGATCTGGTT
TCGCCGCAGACTTGCTGTTCTGACATCGCTCGGGAGCTGCTACGCGGCAGCTTTGGAGGGATCAAGTACGTCAAT
AACGTCGGGGACGTCATTATCCCGATGGACCGCATGGCGGAACTGGGCCTTGCGACAGTTGGCGAGCCATATCAA
GTGTTGGCCATGAAGGACTGGACGAGCCAAGCCATTGAGGCCGGCATGCACCCGGCTGTTGGAGCCCTCGTCGAG
GCGTTGGATGATGCCGGAGTGGAGAGGTATCCGGCACTTTTGCGGCAAGAGCACAACACGTAG
Transcript >Hirsu2|3120
ATGGCTTCCCCTGCTCCTCTGGTCAAGGAACAGCTCGAGCGAGCACTAAGCTACATCCGCAGCGTTGAAGCTGAC
TGCGTCTTCGACTCCGAGTCCGTCAATTTGGAAACTCTCACCGCTGGAAAGCTGCCCGAAAACCCCTGGATCATT
GTCAATTGGAATTCCGTGCCCGCGACCCTCCCGGTCAGGGTTGAAAGACTCGAAAACCAGCAGCTCTTCAAGAGT
GATAAGACGTACTGGCTGGTCGGACTATCAGGTGCCCTAGGGATATCGCTGTGTGACTGGATGATTGATCGGGGC
GTCAAACATCTTGTTCTTACCAGTAGAAACCCAAAGATCGATACTCGCTGGATCGACGACCACAGGAGGGATGGT
GTCACCATCGAGATTTTGTGCTGTGACGTGACAGATGAAGAGGCCATTAAAGCTGTCCATCAGACAATAGTGGAA
AAGCTCCCGCCCATTGCTGGGCTTCTCAACGGCGCAATGGTGCTCCGCGATATCTCTGTGCGCAATATGGAATTC
GAGCATGTAATGGACGTTATTCGACCAAAGGTTCTGGGCAGCATCCACCTGGATCGCATCTTTCACGACATTGAT
CTCGACTTTTTCGTGCTGCTGTCTTCGATCAACTGCGTGATCGGCAACGTTGGCCAGGCAAACTATGCCGCAGCT
AACATGGGCATGATTGGCGTCGCTGGAAATCGTAGAAAGCGCGGCCTCCGGTCGTCGGTGGTCAATGTCGGGGCC
ATCATCGGGGTTGGATATATCACCCAGTCGGCGCGCCAACTCGATGTGACAGTTGCAAAGACAGCCATGATGCAT
TTGTCGGAACAAGACTTTCACCAGATCTTTGCGGAGTGCATGGAAGCTGGCAATCTCGATAATCCAGCCGGACCC
GAGATCTCGACGGGGCTGCTCGACATCATGCCGGAGACCATCGACGTGCCTCCGTGGTATTTTGATCCAAAATTT
GCCCGCTTCATTCTCAATCGTACCGATAAAAATGATGAAAAGGAGCAAGCAAACACGACAAGCACTCAAGACCGC
CTTCTGGCATGTCGATCAGACGAGGATGTGGTTCAAGTTGTCCAGAAGGCCTTTGCCGCTCAATTGCGCAGAATC
TTGCAAATATCCACGACTGACGACGACTTGTTGAGCATGCGCGGCGGAGAGCTTGGTCTGGACTCACTCGTCTCC
GTTGACATTCGCACTTGGTTTCTGAAGAATCTCCAGGTCAGCATTCCTGTGCTGAAGATCATGGCGAACGACGTG
CAAATGTCGGAACTGGTCGACCTGGCCTGCGAGGGGATTCCCGCCGAGTTAGTTCCAGGGGCTCGGGTCCAGCCC
TCTTCTGTCGATAGTAGCGGACAAAGCGCGGCATCGTCGTCCGCTGTGGCCTCGCCAGCCGTGACGCCTCTTACC
AGCTCGGAGAGCATGACGCTGCCTGGGGAGAAAGGCATTGACGCCTTGGTAGACTGGGAGACAGAGTGTCAGCCG
CCGGAGCCAGAAGTCTGTTTTCACCTTTCTCCACAATCCCAAAAGCCCAAGCCGAAACCTCGTGTGGTGGTCGTC
ACGGGCTGCAGCGGGCTTCTGGGTCACCACCTGCTCAAAACGCTGGTGGACCAGGCGTCTATCCAGAAGATCGTC
TGTGTTGCCGTTCGCCGCCTCTCGGAGCGGCTCAAGTCGAATCAGATTCCACCCCCCAGCGACAGGATCGTGTAT
TTCGAGGGTGACCTCGGCCTTCCCCGGTTCGGTCTCGATCCAGATCAATGGACCGAGTTGTTCAGCGAGGCCGAC
GCTGTTATTCACAACGGCTCCGACACATCGCATCTCAAGTACTATTCAGCCCTGCGTCGGACCAATGTGGAATCC
ACAAGGCAGCTGATTAGCGCATGTCTACCGCGCATGACGCCAATCCACTATGTGTCTTCAGCGGGCGTTGCGTTG
TTCGCCGGGCTCGACGCTTTCCCCGAAATATCATGCACCGGCACAGAGAAACAGCCGCCGCTGGATGGCGCGCAC
GGTTACATGTGCGGGAAATGGGTCTGTGAGAACCTCCTTGAGCGGGTCCATGAGAAATACGGACTGCAGGTTGTC
ATACAGCGGCCGTCCACTATCATTCGTGAGGGCCAAGATGCCGACACGGAACGAGCCGAATTCGACTGGGTGAAC
GCTCTGCTTCATTACTCGCACAAGATCAGAGCGGTGCCCAAGGTCGAGCACAACAGCGGCGTATTCGATCTGGTT
TCGCCGCAGACTTGCTGTTCTGACATCGCTCGGGAGCTGCTACGCGGCAGCTTTGGAGGGATCAAGTACGTCAAT
AACGTCGGGGACGTCATTATCCCGATGGACCGCATGGCGGAACTGGGCCTTGCGACAGTTGGCGAGCCATATCAA
GTGTTGGCCATGAAGGACTGGACGAGCCAAGCCATTGAGGCCGGCATGCACCCGGCTGTTGGAGCCCTCGTCGAG
GCGTTGGATGATGCCGGAGTGGAGAGGTATCCGGCACTTTTGCGGCAAGAGCACAACACGTAG
Gene >Hirsu2|3120
ATGGCTTCCCCTGCTCCTCTGGTCAAGGAACAGCTCGAGCGAGCACTAAGCTACATCCGCAGCGTTGAAGCTGAC
TGCGTCTTCGACTCCGAGTCCGTCAATTTGGAAACTCTCACCGCTGGAAAGCTGCCCGAAAACCCCTGGATCATT
GTCAATTGGAATTCCGTGCCCGCGACCCTCCCGGTCAGGGTTGAAAGACTCGAAAACCAGCAGCTCTTCAAGAGT
GATAAGACGTACTGGCTGGTCGGACTATCAGGTGCCCTAGGGATATCGCTGTGTGACTGGATGATTGATCGGGGC
GTCAAACATCTTGTTCTTACCAGTAGAAACCCAAAGATCGATACTCGCTGGATCGACGACCACAGGAGGGATGGT
GTCACCATCGAGATTTTGTGCTGGTATGTTCTAGCGCACCATGACAACATGAATTTGCTTGCTCGGTCTCTGCCT
CTTCCTGTTTGAAATGAGCAAACTACATGTTTTGTATTCTTTAACACCCCTATTCCCCTTCCTCTTCCCCCCCAT
GCCAGCCGTTGCTAACCGACTTTTCTTCCCACAGTGACGTGACAGATGAAGAGGCCATTAAAGCTGTCCATCAGA
CAATAGTGGAAAAGCTCCCGCCCATTGCTGGGCTTCTCAACGGCGCAATGGTGCTCCGCGATATCTCTGTGCGCA
ATATGGAATTCGAGCATGTAATGGACGTTATTCGACCAAAGGTTCTGGGCAGCATCCACCTGGATCGCATCTTTC
ACGACATTGATCTCGACTTTTTCGTGCTGCTGTCTTCGATCAACTGCGTGATCGGCAACGTTGGCCAGGCAAACT
ATGCCGCAGCTAACATGGGCATGATTGGCGTCGCTGGAAATCGTAGAAAGCGCGGCCTCCGGTCGTCGGTGGTCA
ATGTCGGGGCCATCATCGGGGTTGGATATATCACCCAGTCGGCGCGCCAACTCGATGTGACAGTTGCAAAGACAG
CCATGATGCATTTGTCGGAACAAGACTTTCACCAGATCTTTGCGGAGTGCATGGAAGCTGGCAATCTCGATAATC
CAGCCGGACCCGAGATCTCGACGGGGCTGCTCGACATCATGCCGGAGACCATCGACGTGCCTCCGTGGTATTTTG
ATCCAAAATTTGCCCGCTTCATTCTCAATCGTACCGATAAAAATGATGAAAAGGAGCAAGCAAACACGACAAGCA
CTCAAGACCGCCTTCTGGCATGTCGATCAGACGAGGATGTGGTTCAAGTTGTCCAGAAGGCCTTTGCCGCTCAAT
TGCGCAGAATCTTGCAAATATCCACGACTGACGACGACTTGTTGAGCATGCGCGGCGGAGAGCTTGGTCTGGACT
CACTCGTCTCCGTTGACATTCGCACTTGGTTTCTGAAGAATCTCCAGGTCAGCATTCCTGTGCTGAAGATCATGG
CGAACGACGTGCAAATGTCGGAACTGGTCGACCTGGCCTGCGAGGGGATTCCCGCCGAGTTAGTTCCAGGGGCTC
GGGTCCAGCCCTCTTCTGTCGATAGTAGCGGACAAAGCGCGGCATCGTCGTCCGCTGTGGCCTCGCCAGCCGTGA
CGCCTCTTACCAGCTCGGAGAGCATGACGCTGCCTGGGGAGAAAGGCATTGACGCCTTGGTAGACTGGGAGACAG
AGTGTCAGCCGCCGGAGCCAGAAGTCTGTTTTCACCTTTCTCCACAATCCCAAAAGCCCAAGCCGAAACCTCGTG
TGGTGGTCGTCACGGGCTGCAGCGGGCTTCTGGGTCACCACCTGCTCAAAACGCTGGTGGACCAGGCGTCTATCC
AGAAGATCGTCTGTGTTGCCGTTCGCCGCCTCTCGGAGCGGCTCAAGTCGAATCAGATTCCACCCCCCAGCGACA
GGATCGTGTATTTCGAGGGTGACCTCGGCCTTCCCCGGTTCGGTCTCGATCCAGATCAATGGACCGAGTTGTTCA
GCGAGGCCGACGCTGTTATTCACAACGGCTCCGACACATCGCATCTCAAGTACTATTCAGCCCTGCGTCGGACCA
ATGTGGAATCCACAAGGCAGCTGATTAGCGCATGTCTACCGCGCATGACGCCAATCCACTATGTGTCTTCAGCGG
GCGTTGCGTTGTTCGCCGGGCTCGACGCTTTCCCCGAAATATCATGCACCGGCACAGAGAAACAGCCGCCGCTGG
ATGGCGCGCACGGTTACATGTGCGGGAAATGGGTCTGTGAGAACCTCCTTGAGCGGGTCCATGAGAAATACGGAC
TGCAGGTTGTCATACAGCGGCCGTCCACTATCATTCGTGAGGGCCAAGATGCCGACACGGAACGAGCCGAATTCG
ACTGGGTGAACGCTCTGCTTCATTACTCGCACAAGATCAGAGCGGTGCCCAAGGTCGAGCACAACAGCGGCGTAT
TCGATCTGGTTTCGCCGCAGACTTGCTGTTCTGACATCGCTCGGGAGCTGCTACGCGGCAGCTTTGGAGGGATCA
AGTACGTCAATAACGTCGGGGACGTCATTATCCCGATGGACCGCATGGCGGAACTGGGCCTTGCGACAGTTGGCG
AGCCATATCAAGTGTTGGCCATGAAGGACTGGACGAGCCAAGCCATTGAGGCCGGCATGCACCCGGCTGTTGGAG
CCCTCGTCGAGGCGTTGGATGATGCCGGAGTGGAGAGGTATCCGGCACTTTTGCGGCAAGAGCACAACACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail