Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3118
Gene name
LocationContig_18:5382..6390
Strand-
Gene length (bp)1008
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.0E-22 9 197
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 2.0E-13 10 174
PF04321 RmlD_sub_bind RmlD substrate binding domain 6.7E-14 9 179
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 1.5E-08 42 118
PF07993 NAD_binding_4 Male sterility protein 3.5E-06 85 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 9 313 1.0E-12
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 8 172 2.0E-10
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 9 158 5.0E-10
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 8 177 2.0E-09
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 9 177 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 9 313 1.0E-12
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 8 172 2.0E-10
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 9 158 5.0E-10
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 8 177 2.0E-09
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 9 177 2.0E-09
sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 9 181 4.0E-09
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 6 177 6.0E-09
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 9 172 6.0E-09
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 4 177 2.0E-08
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 9 177 2.0E-08
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 9 177 2.0E-08
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 9 158 3.0E-08
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 6 172 3.0E-08
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 9 169 4.0E-08
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 9 177 6.0E-08
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 9 177 6.0E-08
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 2 177 8.0E-08
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 9 156 9.0E-08
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 9 120 2.0E-07
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 9 191 3.0E-07
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 1 161 5.0E-07
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 9 120 5.0E-07
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 3 172 8.0E-07
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 9 156 1.0E-06
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 9 120 2.0E-06
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 6 161 2.0E-06
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 9 120 3.0E-06
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 6 120 3.0E-06
sp|P0C7J0|RMLB_XANCP dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rfbB PE=3 SV=1 10 179 4.0E-06
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 9 177 5.0E-06
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 9 177 5.0E-06
sp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1 9 177 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3118
MAAPPAYDVLVTGSAGHLGTALMLVLPSQGYSPLGIDIVASETTTRVGSINDRALVADLFRRHPIRHVLHAATLH
KPHVGSHAKECFVETNITGTLVLAEEAARAGAHAFVFFSTTSAFGMALSPGRGSPAAWIDERVAPEPKNIYGVTK
AAAEDVCRLVHLQSRMPVLVLRTSRFFPEPDDDDDRRRAMDDANLKVLELAYRRCDIRDVVSAAVCAMRRARDIG
WARYVISAPSPFANDAETLAALDRSPADVFRRAAPGLDAVFQQRGWRHLDRVDRVYDSSKAVRELGWRPEYTFSR
AIEMLASGREWQSDLVAKVGRKGYHAVSTGVYTMR*
Coding >Hirsu2|3118
ATGGCCGCCCCTCCGGCCTACGACGTCCTCGTCACCGGCTCCGCGGGCCACCTCGGGACGGCCCTCATGCTGGTG
CTCCCCTCGCAGGGCTACTCGCCGCTGGGCATCGACATCGTGGCGTCGGAGACGACGACCCGCGTCGGATCCATC
AACGACCGGGCCCTGGTCGCGGACCTGTTCCGGCGGCACCCCATCCGGCACGTGCTGCACGCGGCGACGCTGCAC
AAGCCGCACGTCGGCAGCCACGCCAAGGAGTGCTTCGTCGAGACCAACATCACGGGCACGCTCGTGCTGGCCGAG
GAGGCGGCGCGGGCGGGCGCGCACGCCTTCGTCTTCTTCAGCACCACGAGCGCGTTCGGCATGGCGCTCAGCCCG
GGTCGCGGCTCGCCCGCCGCCTGGATCGACGAGCGCGTCGCGCCCGAGCCCAAGAACATCTACGGCGTCACCAAA
GCCGCGGCCGAGGACGTCTGCCGCCTAGTCCACCTGCAGAGCCGCATGCCGGTCCTTGTCCTGCGCACGAGCCGC
TTCTTCCCCGAGCCCGACGACGACGACGACCGCCGCCGCGCCATGGACGACGCCAACCTCAAGGTGCTCGAGCTG
GCCTACCGCCGCTGCGACATCCGCGACGTCGTCTCGGCTGCCGTGTGCGCCATGCGCCGCGCCCGTGACATCGGC
TGGGCCAGGTACGTCATCAGCGCGCCCTCGCCCTTCGCCAACGACGCCGAGACGCTCGCCGCCCTCGACCGCAGC
CCGGCCGACGTCTTCCGCCGGGCCGCGCCGGGCCTCGACGCCGTCTTTCAGCAGCGGGGGTGGCGCCATCTCGAC
AGGGTCGACAGGGTCTACGACTCGAGCAAGGCGGTGCGCGAGCTGGGCTGGCGGCCCGAGTATACCTTTTCGCGC
GCAATTGAGATGCTGGCCAGCGGCCGCGAGTGGCAGAGCGATCTCGTGGCCAAGGTCGGCAGAAAGGGCTATCAC
GCTGTCAGCACGGGCGTGTACACGATGCGGTGA
Transcript >Hirsu2|3118
ATGGCCGCCCCTCCGGCCTACGACGTCCTCGTCACCGGCTCCGCGGGCCACCTCGGGACGGCCCTCATGCTGGTG
CTCCCCTCGCAGGGCTACTCGCCGCTGGGCATCGACATCGTGGCGTCGGAGACGACGACCCGCGTCGGATCCATC
AACGACCGGGCCCTGGTCGCGGACCTGTTCCGGCGGCACCCCATCCGGCACGTGCTGCACGCGGCGACGCTGCAC
AAGCCGCACGTCGGCAGCCACGCCAAGGAGTGCTTCGTCGAGACCAACATCACGGGCACGCTCGTGCTGGCCGAG
GAGGCGGCGCGGGCGGGCGCGCACGCCTTCGTCTTCTTCAGCACCACGAGCGCGTTCGGCATGGCGCTCAGCCCG
GGTCGCGGCTCGCCCGCCGCCTGGATCGACGAGCGCGTCGCGCCCGAGCCCAAGAACATCTACGGCGTCACCAAA
GCCGCGGCCGAGGACGTCTGCCGCCTAGTCCACCTGCAGAGCCGCATGCCGGTCCTTGTCCTGCGCACGAGCCGC
TTCTTCCCCGAGCCCGACGACGACGACGACCGCCGCCGCGCCATGGACGACGCCAACCTCAAGGTGCTCGAGCTG
GCCTACCGCCGCTGCGACATCCGCGACGTCGTCTCGGCTGCCGTGTGCGCCATGCGCCGCGCCCGTGACATCGGC
TGGGCCAGGTACGTCATCAGCGCGCCCTCGCCCTTCGCCAACGACGCCGAGACGCTCGCCGCCCTCGACCGCAGC
CCGGCCGACGTCTTCCGCCGGGCCGCGCCGGGCCTCGACGCCGTCTTTCAGCAGCGGGGGTGGCGCCATCTCGAC
AGGGTCGACAGGGTCTACGACTCGAGCAAGGCGGTGCGCGAGCTGGGCTGGCGGCCCGAGTATACCTTTTCGCGC
GCAATTGAGATGCTGGCCAGCGGCCGCGAGTGGCAGAGCGATCTCGTGGCCAAGGTCGGCAGAAAGGGCTATCAC
GCTGTCAGCACGGGCGTGTACACGATGCGGTGA
Gene >Hirsu2|3118
ATGGCCGCCCCTCCGGCCTACGACGTCCTCGTCACCGGCTCCGCGGGCCACCTCGGGACGGCCCTCATGCTGGTG
CTCCCCTCGCAGGGCTACTCGCCGCTGGGCATCGACATCGTGGCGTCGGAGACGACGACCCGCGTCGGATCCATC
AACGACCGGGCCCTGGTCGCGGACCTGTTCCGGCGGCACCCCATCCGGCACGTGCTGCACGCGGCGACGCTGCAC
AAGCCGCACGTCGGCAGCCACGCCAAGGAGTGCTTCGTCGAGACCAACATCACGGGCACGCTCGTGCTGGCCGAG
GAGGCGGCGCGGGCGGGCGCGCACGCCTTCGTCTTCTTCAGCACCACGAGCGCGTTCGGCATGGCGCTCAGCCCG
GGTCGCGGCTCGCCCGCCGCCTGGATCGACGAGCGCGTCGCGCCCGAGCCCAAGAACATCTACGGCGTCACCAAA
GCCGCGGCCGAGGACGTCTGCCGCCTAGTCCACCTGCAGAGCCGCATGCCGGTCCTTGTCCTGCGCACGAGCCGC
TTCTTCCCCGAGCCCGACGACGACGACGACCGCCGCCGCGCCATGGACGACGCCAACCTCAAGGTGCTCGAGCTG
GCCTACCGCCGCTGCGACATCCGCGACGTCGTCTCGGCTGCCGTGTGCGCCATGCGCCGCGCCCGTGACATCGGC
TGGGCCAGGTACGTCATCAGCGCGCCCTCGCCCTTCGCCAACGACGCCGAGACGCTCGCCGCCCTCGACCGCAGC
CCGGCCGACGTCTTCCGCCGGGCCGCGCCGGGCCTCGACGCCGTCTTTCAGCAGCGGGGGTGGCGCCATCTCGAC
AGGGTCGACAGGGTCTACGACTCGAGCAAGGCGGTGCGCGAGCTGGGCTGGCGGCCCGAGTATACCTTTTCGCGC
GCAATTGAGATGCTGGCCAGCGGCCGCGAGTGGCAGAGCGATCTCGTGGCCAAGGTCGGCAGAAAGGGCTATCAC
GCTGTCAGCACGGGCGTGTACACGATGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail