Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3108
Gene name
LocationContig_1797:518..1590
Strand-
Gene length (bp)1072
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 1.2E-12 97 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 45 337 6.0E-56
sp|Q69JW3|SUT5_ORYSJ Sucrose transport protein SUT5 OS=Oryza sativa subsp. japonica GN=SUT5 PE=1 SV=1 40 338 5.0E-37
sp|A2X6E6|SUT5_ORYSI Sucrose transport protein SUT5 OS=Oryza sativa subsp. indica GN=SUT5 PE=3 SV=1 40 338 6.0E-37
sp|Q39231|SUC2_ARATH Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2 45 337 2.0E-34
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 82 337 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14091|SUT1_SCHPO General alpha-glucoside permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sut1 PE=3 SV=1 45 337 6.0E-56
sp|Q69JW3|SUT5_ORYSJ Sucrose transport protein SUT5 OS=Oryza sativa subsp. japonica GN=SUT5 PE=1 SV=1 40 338 5.0E-37
sp|A2X6E6|SUT5_ORYSI Sucrose transport protein SUT5 OS=Oryza sativa subsp. indica GN=SUT5 PE=3 SV=1 40 338 6.0E-37
sp|Q39231|SUC2_ARATH Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2 45 337 2.0E-34
sp|Q9FG00|SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1 82 337 3.0E-34
sp|Q9C8X2|SUC5_ARATH Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1 82 337 4.0E-33
sp|Q67YF8|SUC7_ARATH Sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=2 SV=2 82 337 7.0E-32
sp|Q03411|SUT_SPIOL Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1 82 337 1.0E-30
sp|Q9FE59|SUC4_ARATH Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2 82 337 6.0E-30
sp|Q39232|SUC1_ARATH Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1 82 337 8.0E-30
sp|Q6A329|SUC6_ARATH Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2 82 337 9.0E-30
sp|Q9ZVK6|SUC8_ARATH Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1 82 337 4.0E-29
sp|Q10R54|SUT1_ORYSJ Sucrose transport protein SUT1 OS=Oryza sativa subsp. japonica GN=SUT1 PE=1 SV=1 81 337 6.0E-29
sp|Q9LKH3|SUT1_ORYSI Sucrose transport protein SUT1 OS=Oryza sativa subsp. indica GN=SUT1 PE=3 SV=1 81 337 6.0E-29
sp|O80605|SUC3_ARATH Sucrose transport protein SUC3 OS=Arabidopsis thaliana GN=SUC3 PE=1 SV=1 57 337 5.0E-28
sp|Q948L0|SUT3_ORYSJ Sucrose transport protein SUT3 OS=Oryza sativa subsp. japonica GN=SUT3 PE=2 SV=1 81 337 6.0E-28
sp|Q944W2|SUT3_ORYSI Sucrose transport protein SUT3 OS=Oryza sativa subsp. indica GN=SUT3 PE=3 SV=1 81 337 2.0E-27
sp|Q6YK44|SUT4_ORYSJ Sucrose transport protein SUT4 OS=Oryza sativa subsp. japonica GN=SUT4 PE=2 SV=1 52 337 4.0E-27
sp|B8AF63|SUT4_ORYSI Sucrose transport protein SUT4 OS=Oryza sativa subsp. indica GN=SUT4 PE=3 SV=1 52 337 4.0E-27
sp|Q0ILJ3|SUT2_ORYSJ Sucrose transport protein SUT2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2 82 337 1.0E-24
sp|A2ZN77|SUT2_ORYSI Sucrose transport protein SUT2 OS=Oryza sativa subsp. indica GN=SUT2 PE=2 SV=2 82 337 2.0E-24
sp|P58355|S45A2_MOUSE Membrane-associated transporter protein OS=Mus musculus GN=Slc45a2 PE=1 SV=1 65 287 2.0E-23
sp|Q9UMX9|S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens GN=SLC45A2 PE=1 SV=2 73 282 3.0E-21
sp|Q0P5V9|S45A4_MOUSE Solute carrier family 45 member 4 OS=Mus musculus GN=Slc45a4 PE=1 SV=1 82 298 3.0E-21
sp|Q5BKX6|S45A4_HUMAN Solute carrier family 45 member 4 OS=Homo sapiens GN=SLC45A4 PE=1 SV=2 82 299 2.0E-19
sp|Q4LE88|S45A2_PIG Membrane-associated transporter protein OS=Sus scrofa GN=SLC45A2 PE=2 SV=2 73 297 2.0E-19
sp|Q8BIV7|S45A1_MOUSE Proton-associated sugar transporter A OS=Mus musculus GN=Slc45a1 PE=1 SV=3 68 293 7.0E-14
sp|Q8K4S3|S45A1_RAT Proton-associated sugar transporter A OS=Rattus norvegicus GN=Slc45a1 PE=2 SV=1 62 293 9.0E-14
sp|Q9Y2W3|S45A1_HUMAN Proton-associated sugar transporter A OS=Homo sapiens GN=SLC45A1 PE=2 SV=4 82 293 2.0E-13
sp|Q96JT2|S45A3_HUMAN Solute carrier family 45 member 3 OS=Homo sapiens GN=SLC45A3 PE=2 SV=1 65 338 1.0E-12
sp|Q8K0H7|S45A3_MOUSE Solute carrier family 45 member 3 OS=Mus musculus GN=Slc45a3 PE=2 SV=1 65 338 3.0E-12
sp|Q95KI5|S45A3_MACFA Solute carrier family 45 member 3 OS=Macaca fascicularis GN=SLC45A3 PE=2 SV=1 65 338 5.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 70 87 17
2 107 129 22
3 142 161 19
4 181 203 22
5 258 280 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3108
MAAPLSSSRGGGGEPSSAGRGQAAVGPGDGRLPAAERACRRVVDERSALLASDAAGADHAADEAQRTKSLWYMAM
LTVSIGGLQIAWSVELSNGSPYLLSLGLSKSLMALVWIAGPLTGTLVVPYVGVLSDRCRLRWGRRRPFLVGGALA
TVLSLLFLAWVREIVGGVVGLAGGDPGSPAVRTAVVAAAVVGIYLLDIAVNTVQAACRAFIVDAAPAHQQELANS
MASRFTGVGNILGYLAGYADLPAHLWFLGDTQFKILCAIASVALAATVALSVASIPERDPRTGGGGRARKAPGFA
SFFLHIVASIRRLPPQTKRVCQVQFCAWVGFFPLLFYT*
Coding >Hirsu2|3108
ATGGCTGCCCCCCTTTCGTCCTCCCGCGGCGGCGGCGGCGAGCCGTCGTCGGCCGGCCGTGGCCAGGCGGCCGTG
GGACCCGGCGACGGGCGGCTGCCGGCAGCGGAACGAGCCTGCCGCCGGGTCGTCGACGAGCGCTCCGCCCTCCTA
GCTTCCGACGCGGCCGGGGCGGACCACGCCGCCGACGAGGCGCAGCGCACCAAGAGCCTGTGGTACATGGCGATG
CTGACGGTCAGCATCGGCGGGCTCCAGATCGCCTGGTCCGTCGAGCTGTCCAACGGGTCGCCGTACCTGCTGTCG
CTGGGCCTGAGCAAGTCGCTGATGGCGCTGGTCTGGATCGCCGGCCCGCTGACGGGCACCCTGGTGGTGCCCTAC
GTCGGCGTCCTGAGCGACCGCTGCCGCCTCCGCTGGGGCAGGCGGCGGCCGTTCCTGGTCGGCGGCGCCCTGGCC
ACCGTCCTGTCCCTGCTGTTCCTGGCCTGGGTCCGCGAGATTGTCGGCGGCGTCGTCGGGCTGGCGGGCGGCGAC
CCGGGCTCGCCCGCGGTCCGCACCGCCGTCGTCGCCGCCGCCGTCGTCGGCATCTACCTGCTCGACATCGCCGTC
AACACGGTCCAGGCCGCCTGCCGCGCCTTCATCGTCGACGCCGCGCCCGCCCACCAGCAGGAGCTGGCCAACTCC
ATGGCCAGCCGCTTCACCGGCGTCGGCAACATCCTGGGCTACCTGGCCGGCTACGCCGACCTGCCCGCCCACCTC
TGGTTCCTGGGCGACACGCAGTTCAAGATCCTCTGCGCCATCGCCTCGGTCGCGCTCGCCGCCACCGTCGCCCTC
AGCGTCGCCTCCATCCCGGAGCGGGACCCCCGGACGGGCGGAGGGGGCCGGGCCAGGAAGGCCCCGGGCTTCGCC
TCCTTCTTCTTGCACATCGTCGCGTCCATCAGGCGGCTCCCGCCGCAGACGAAGCGGGTCTGCCAGGTGCAGTTC
TGCGCCTGGGTCGGCTTCTTCCCGCTCCTGTTCTACACATGA
Transcript >Hirsu2|3108
ATGGCTGCCCCCCTTTCGTCCTCCCGCGGCGGCGGCGGCGAGCCGTCGTCGGCCGGCCGTGGCCAGGCGGCCGTG
GGACCCGGCGACGGGCGGCTGCCGGCAGCGGAACGAGCCTGCCGCCGGGTCGTCGACGAGCGCTCCGCCCTCCTA
GCTTCCGACGCGGCCGGGGCGGACCACGCCGCCGACGAGGCGCAGCGCACCAAGAGCCTGTGGTACATGGCGATG
CTGACGGTCAGCATCGGCGGGCTCCAGATCGCCTGGTCCGTCGAGCTGTCCAACGGGTCGCCGTACCTGCTGTCG
CTGGGCCTGAGCAAGTCGCTGATGGCGCTGGTCTGGATCGCCGGCCCGCTGACGGGCACCCTGGTGGTGCCCTAC
GTCGGCGTCCTGAGCGACCGCTGCCGCCTCCGCTGGGGCAGGCGGCGGCCGTTCCTGGTCGGCGGCGCCCTGGCC
ACCGTCCTGTCCCTGCTGTTCCTGGCCTGGGTCCGCGAGATTGTCGGCGGCGTCGTCGGGCTGGCGGGCGGCGAC
CCGGGCTCGCCCGCGGTCCGCACCGCCGTCGTCGCCGCCGCCGTCGTCGGCATCTACCTGCTCGACATCGCCGTC
AACACGGTCCAGGCCGCCTGCCGCGCCTTCATCGTCGACGCCGCGCCCGCCCACCAGCAGGAGCTGGCCAACTCC
ATGGCCAGCCGCTTCACCGGCGTCGGCAACATCCTGGGCTACCTGGCCGGCTACGCCGACCTGCCCGCCCACCTC
TGGTTCCTGGGCGACACGCAGTTCAAGATCCTCTGCGCCATCGCCTCGGTCGCGCTCGCCGCCACCGTCGCCCTC
AGCGTCGCCTCCATCCCGGAGCGGGACCCCCGGACGGGCGGAGGGGGCCGGGCCAGGAAGGCCCCGGGCTTCGCC
TCCTTCTTCTTGCACATCGTCGCGTCCATCAGGCGGCTCCCGCCGCAGACGAAGCGGGTCTGCCAGGTGCAGTTC
TGCGCCTGGGTCGGCTTCTTCCCGCTCCTGTTCTACACATGA
Gene >Hirsu2|3108
ATGGCTGCCCCCCTTTCGTCCTCCCGCGGCGGCGGCGGCGAGCCGTCGTCGGCCGGCCGTGGCCAGGCGGCCGTG
GGACCCGGCGACGGGCGGCTGCCGGCAGCGGAACGAGCCTGCCGCCGGGTCGTCGACGAGCGCTCCGCCCTCCTA
GCTTCCGACGCGGCCGGGGCGGACCACGCCGCCGACGAGGCGCAGCGCACCAAGAGCCTGTGGTACATGGCGATG
CTGACGGTCAGCATCGGCGGGCTCCAGATCGCCTGGTCCGTCGAGCTGTCCAACGGGTCGCCGTACCTGCTGTCG
CTGGGCCTGAGCAAGTCGCTGATGGCGCTGGTCTGGATCGCCGGCCCGCTGACGGGCACCCTGGTGGTGCCCTAC
GTCGGCGTCCTGAGCGACCGCTGCCGCCTCCGCTGGGGCAGGCGGCGGCCGTTCCTGGTCGGCGGCGCCCTGGCC
ACCGTCCTGTCCCTGCTGTTCCTGGCCTGGGTCCGCGAGATTGTCGGCGGCGTCGTCGGGCTGGCGGGCGGCGAC
CCGGGCTCGCCCGCGGTCCGCACCGCCGTCGTCGCCGCCGCCGTCGTCGGCATCTACCTGCTCGACATCGCCGTC
AACACGGTCCAGGCCGCCTGCCGCGCCTTCATCGTCGACGCCGCGCCCGCCCACCAGCAGGAGCTGGCCAACTCC
ATGGCCAGCCGCTTCACCGGCGTCGGCAACATCCTGGGCTACCTGGCCGGCTACGCCGACCTGCCCGCCCACCTC
TGGTTCCTGGGCGACACGCAGTTCAAGATCCTCTGCGCCATCGCCTCGGTCGCGCTCGCCGCCACCGTCGCCCTC
AGCGTCGCCTCCATCCCGGAGCGGGACCCCCGGACGGGCGGAGGGGGCCGGGCCAGGAAGGCCCCGGGCTTCGCC
TCCTTCTTCTTGCACATCGTCGCGTCCATCAGGCGGCTCCCGCCGCAGACGAAGCGGGTCTGCCAGGTGCAGTTC
TGCGCCTGGGTCGGCTTCTTCCCGCTCCTGTTCTACACGTCATCGTACATTGGCGAGATCTACGTGCAGCCGTAC
CTGAGGGAGAGGCCGCAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail