Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|310
Gene name
LocationContig_106:8873..10499
Strand+
Gene length (bp)1626
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 9.4E-45 115 330
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 2.2E-08 214 424
PF06422 PDR_CDR CDR ABC transporter 2.4E-04 387 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 1 429 1.0E-131
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 428 2.0E-126
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 432 8.0E-124
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 1 435 3.0E-123
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 1 438 3.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 1 429 1.0E-131
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 428 2.0E-126
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 432 8.0E-124
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 1 435 3.0E-123
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 1 438 3.0E-122
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 1 432 3.0E-122
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 1 438 4.0E-122
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 1 435 2.0E-121
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 1 432 2.0E-118
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 1 429 7.0E-86
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 2 439 9.0E-84
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 2 427 5.0E-79
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 1 430 3.0E-72
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 2 407 3.0E-72
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 1 430 9.0E-70
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 1 430 1.0E-68
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 1 430 7.0E-68
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 1 434 4.0E-64
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 1 434 2.0E-62
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 1 430 1.0E-61
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 1 430 3.0E-58
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 6 429 1.0E-47
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 2 426 6.0E-46
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 2 429 2.0E-45
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 2 344 9.0E-24
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 2 330 1.0E-22
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 2 334 6.0E-21
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 2 330 8.0E-21
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 2 330 1.0E-20
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 2 334 2.0E-20
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 2 362 3.0E-20
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 2 372 9.0E-20
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 2 413 1.0E-19
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 2 334 4.0E-19
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 2 335 8.0E-19
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 2 330 2.0E-18
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 2 347 2.0E-18
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 2 346 4.0E-17
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 2 330 6.0E-17
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 2 335 1.0E-16
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 2 334 1.0E-16
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 2 331 1.0E-16
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 2 334 2.0E-16
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 2 400 2.0E-16
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 2 334 2.0E-16
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 2 334 4.0E-16
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 2 328 5.0E-16
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 2 334 6.0E-16
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 2 328 7.0E-16
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 2 334 1.0E-15
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 2 334 3.0E-15
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 2 334 1.0E-14
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 2 331 2.0E-14
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 2 400 5.0E-14
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 2 328 5.0E-14
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 2 334 5.0E-14
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 2 334 9.0E-14
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 2 362 1.0E-13
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 2 328 3.0E-13
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 2 328 3.0E-13
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 2 334 3.0E-13
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 7 328 9.0E-13
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 7 328 9.0E-13
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 2 334 1.0E-12
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 2 328 8.0E-12
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 2 334 9.0E-12
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 2 420 3.0E-11
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 6 420 3.0E-11
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 2 421 2.0E-10
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 2 342 4.0E-10
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 2 340 5.0E-10
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 2 218 1.0E-09
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 2 328 4.0E-09
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 2 340 2.0E-08
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 2 339 2.0E-08
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 2 420 3.0E-08
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 2 328 3.0E-08
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 2 342 4.0E-08
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 6 339 4.0E-08
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 184 427 1.0E-07
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 2 364 1.0E-07
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 6 368 2.0E-07
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 2 245 2.0E-07
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 2 328 3.0E-07
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 2 216 4.0E-07
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 2 312 4.0E-07
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 2 412 5.0E-07
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 6 339 8.0E-07
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 2 384 1.0E-06
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 6 403 2.0E-06
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 2 342 3.0E-06
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 3 421 4.0E-06
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 2 342 4.0E-06
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 2 238 5.0E-06
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 6 339 6.0E-06
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 2 288 7.0E-06
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 2 218 8.0E-06
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 3 460 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0016887 ATPase activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 131 153 22
2 168 190 22
3 211 233 22
4 253 275 22
5 282 304 22
6 406 425 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|310
MLFQRFDRLLLLSKGRTVYFGDVGKNSTTLIDYFTRNGGPPCQPGTNPAEYMLGAIGAAPGAKSGSIDWPAVWKS
SPEYRQVQFQLDKLAATVDGQHGEDDPSAYREFAAPSKDQYLEVTKRVFQQYWRSPSYIYSKALLSVGATLFIGL
SFINEENTLFGLRNQMFGVFTFLTIFPQVVDQILPVFVSQRTMYEARERPSKAYSWKAFMVANILVELAWNSLVG
VASFFCWYYPIGLYRNAEWTNQVDSRGFTVFLHVWLFFLFCGTFANMVIAGIDSADVAGGVVNLFMIMMFAFCGV
LATPEQLPGFWIFMYRVNPFTYVVEGFLGTSLANAPMHCEPSEFIDFNAPGGTTCGDYLAPYIARAGGYVEDAGA
SQCRFCPLAETNAYLSTINVSFSHRWRDFGFMWVYCIFNIAVAIFLYWLVRVPKKEGSRKSVNIPALVSKGKKTK
GLLGLLDRAKGLVKGIRGKIF*
Coding >Hirsu2|310
ATGCTCTTCCAGCGATTCGACCGGCTGCTTCTGCTGTCAAAGGGCCGGACCGTCTATTTCGGCGACGTCGGGAAG
AACTCGACCACTTTGATCGACTACTTCACCCGCAACGGGGGCCCGCCGTGCCAGCCCGGGACCAACCCGGCCGAG
TACATGCTCGGGGCCATCGGGGCGGCGCCGGGGGCCAAGTCGGGCAGCATCGACTGGCCGGCCGTCTGGAAGAGC
AGCCCGGAGTACCGCCAGGTGCAGTTCCAGCTCGACAAGCTGGCGGCCACGGTGGACGGGCAGCACGGAGAAGAC
GACCCGTCGGCCTATCGCGAGTTTGCGGCGCCATCCAAGGACCAGTACCTCGAGGTCACGAAGCGCGTGTTCCAG
CAGTACTGGAGGAGCCCCTCCTACATCTACTCCAAGGCCCTCCTGTCCGTTGGCGCGACGCTGTTCATCGGCCTG
TCCTTCATCAACGAGGAGAACACGCTGTTCGGGCTCCGGAACCAGATGTTTGGCGTCTTCACCTTCCTGACTATC
TTCCCCCAGGTCGTCGACCAGATCCTGCCCGTCTTCGTGTCGCAGCGGACAATGTACGAGGCGCGAGAGCGTCCG
TCAAAGGCGTACTCGTGGAAGGCCTTCATGGTGGCCAACATCCTGGTTGAGCTCGCTTGGAACTCGCTTGTGGGC
GTTGCGTCCTTCTTCTGTTGGTATTACCCGATCGGGCTCTACCGCAACGCCGAGTGGACGAATCAGGTGGACTCG
CGCGGCTTCACCGTCTTCCTGCACGTCTGGCTCTTCTTCCTCTTCTGCGGCACCTTCGCCAATATGGTCATTGCC
GGCATAGACAGCGCCGACGTGGCCGGCGGCGTCGTGAACCTCTTCATGATCATGATGTTTGCCTTCTGCGGCGTG
CTCGCGACGCCGGAGCAGCTGCCCGGCTTCTGGATCTTCATGTACCGCGTCAACCCCTTCACCTATGTCGTCGAG
GGCTTCCTCGGCACTTCCCTGGCGAATGCCCCGATGCACTGCGAGCCCAGCGAGTTCATTGACTTCAACGCTCCC
GGCGGGACGACCTGCGGCGACTACCTCGCCCCTTACATCGCCCGGGCCGGGGGCTACGTCGAGGACGCGGGCGCG
TCCCAGTGCCGCTTCTGCCCCCTGGCTGAGACGAACGCCTACTTGTCGACCATTAATGTCAGCTTCTCGCACCGG
TGGCGAGACTTTGGCTTCATGTGGGTGTACTGCATCTTTAATATCGCCGTCGCCATCTTCCTCTATTGGCTCGTG
CGAGTGCCCAAGAAAGAGGGGAGCAGAAAATCGGTTAATATCCCGGCGCTCGTTTCCAAAGGGAAAAAGACCAAG
GGGCTTTTGGGACTTTTGGATCGCGCAAAGGGGCTCGTGAAGGGCATCAGGGGTAAGATATTCTGA
Transcript >Hirsu2|310
ATGCTCTTCCAGCGATTCGACCGGCTGCTTCTGCTGTCAAAGGGCCGGACCGTCTATTTCGGCGACGTCGGGAAG
AACTCGACCACTTTGATCGACTACTTCACCCGCAACGGGGGCCCGCCGTGCCAGCCCGGGACCAACCCGGCCGAG
TACATGCTCGGGGCCATCGGGGCGGCGCCGGGGGCCAAGTCGGGCAGCATCGACTGGCCGGCCGTCTGGAAGAGC
AGCCCGGAGTACCGCCAGGTGCAGTTCCAGCTCGACAAGCTGGCGGCCACGGTGGACGGGCAGCACGGAGAAGAC
GACCCGTCGGCCTATCGCGAGTTTGCGGCGCCATCCAAGGACCAGTACCTCGAGGTCACGAAGCGCGTGTTCCAG
CAGTACTGGAGGAGCCCCTCCTACATCTACTCCAAGGCCCTCCTGTCCGTTGGCGCGACGCTGTTCATCGGCCTG
TCCTTCATCAACGAGGAGAACACGCTGTTCGGGCTCCGGAACCAGATGTTTGGCGTCTTCACCTTCCTGACTATC
TTCCCCCAGGTCGTCGACCAGATCCTGCCCGTCTTCGTGTCGCAGCGGACAATGTACGAGGCGCGAGAGCGTCCG
TCAAAGGCGTACTCGTGGAAGGCCTTCATGGTGGCCAACATCCTGGTTGAGCTCGCTTGGAACTCGCTTGTGGGC
GTTGCGTCCTTCTTCTGTTGGTATTACCCGATCGGGCTCTACCGCAACGCCGAGTGGACGAATCAGGTGGACTCG
CGCGGCTTCACCGTCTTCCTGCACGTCTGGCTCTTCTTCCTCTTCTGCGGCACCTTCGCCAATATGGTCATTGCC
GGCATAGACAGCGCCGACGTGGCCGGCGGCGTCGTGAACCTCTTCATGATCATGATGTTTGCCTTCTGCGGCGTG
CTCGCGACGCCGGAGCAGCTGCCCGGCTTCTGGATCTTCATGTACCGCGTCAACCCCTTCACCTATGTCGTCGAG
GGCTTCCTCGGCACTTCCCTGGCGAATGCCCCGATGCACTGCGAGCCCAGCGAGTTCATTGACTTCAACGCTCCC
GGCGGGACGACCTGCGGCGACTACCTCGCCCCTTACATCGCCCGGGCCGGGGGCTACGTCGAGGACGCGGGCGCG
TCCCAGTGCCGCTTCTGCCCCCTGGCTGAGACGAACGCCTACTTGTCGACCATTAATGTCAGCTTCTCGCACCGG
TGGCGAGACTTTGGCTTCATGTGGGTGTACTGCATCTTTAATATCGCCGTCGCCATCTTCCTCTATTGGCTCGTG
CGAGTGCCCAAGAAAGAGGGGAGCAGAAAATCGGTTAATATCCCGGCGCTCGTTTCCAAAGGGAAAAAGACCAAG
GGGCTTTTGGGACTTTTGGATCGCGCAAAGGGGCTCGTGAAGGGCATCAGGGGTAAGATATTCTGA
Gene >Hirsu2|310
ATGCTCTTCCAGCGATTCGACCGGCTGCTTCTGCTGTCAAAGGGCCGGACCGTCTATTTCGGCGACGTCGGGAAG
AACTCGACCACTTTGATCGACTACTTCACCCGCAACGGGGGCCCGCCGTGCCAGCCCGGGACCAACCCGGCCGAG
TACATGCTCGGGGCCATCGGGGCGGCGCCGGGGGCCAAGTCGGGCAGCATCGACTGGCCGGCCGTCTGGAAGAGC
AGCCCGGAGTACCGCCAGGTGCAGTTCCAGCTCGACAAGCTGGCGGCCACGGTGGACGGGCAGCACGGAGAAGAC
GACCCGTCGGCCTATCGCGAGTTTGCGGCGCCATCCAAGGACCAGTACCTCGAGGTCACGAAGCGCGTGTTCCAG
CAGTACTGGAGGAGCCCCTCCTACATCTACTCCAAGGCCCTCCTGTCCGTTGGCGCGGTGAGTTTTGCATCACAA
CGATGTTCCTAGAGGCGAGGCCGTCGAGGAACGCGACTGACGAACGGACCCCAAACAGACGCTGTTCATCGGCCT
GTCCTTCATCAACGAGGAGAACACGCTGTTCGGGCTCCGGAACCAGATGTTTGGCGTCTTCACCTTCCTGACTAT
CTTCCCCCAGGTCGTCGACCAGATCCTGCCCGTCTTCGTGTCGCAGCGGACAATGTACGAGGCGCGAGAGCGTCC
GTCAAAGGCGTACTCGTGGAAGGCCTTCATGGTGGCCAACATCCTGGTTGAGCTCGCTTGGAACTCGGTAGGATC
CGCCCGGACCACCCGCGCGCCTTCGCCTGTTACTGACACGCGCTCTCCGTCACGGCAGCTTGTGGGCGTTGCGTC
CTTCTTCTGTTGGTATTACCCGATCGGGCTCTACCGCAACGCCGAGTGGACGAATCAGGTGGACTCGCGCGGCTT
CACCGTCTTCCTGCACGTCTGGCTCTTCTTCCTCTTCTGCGGCACCTTCGCCAATATGGTCATTGCCGGCATAGA
CAGCGCCGACGTGGCCGGCGGCGTCGTGAACCTCTTCATGATCATGATGTTTGCCTTCTGCGGGTATGTACCTAC
AGCACGGACCCGGCCATGGGAGCACATGGAAGCTGACGAGCAATGAACAATCCCAGCGTGCTCGCGACGCCGGAG
CAGCTGCCCGGCTTCTGGATCTTCATGTACCGCGTCAACCCCTTCACCTATGTCGTCGAGGGCTTCCTCGGCACT
TCCCTGGCGAATGCCCCGATGCACTGCGAGCCCAGCGAGTTCATTGACTTCAACGCTCCCGGCGGGACGACCTGC
GGCGACTACCTCGCCCCTTACATCGCCCGGGCCGGGGGCTACGTCGAGGACGCGGGCGCGTCCCAGTGCCGCTTC
TGCCCCCTGGCTGAGACGAACGCCTACTTGTCGACCATTAATGTCAGCTTCTCGCACCGGTGGCGAGACTTTGGC
TTCATGTGGGTGTACTGCATCTTTAATATCGCCGTCGCCATCTTCCTCTATTGGCTCGTGCGAGTGCCCAAGAAA
GAGGGGAGCAGAAAATCGGTTAATATCCCGGCGCTCGTTTCCAAAGGGAAAAAGACCAAGGGGCTTTTGGGACTT
TTGGATCGCGCAAAGGGGCTCGTGAAGGGCATCAGGGGTAAGATATTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail