Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3096
Gene name
LocationContig_1792:149..1796
Strand-
Gene length (bp)1647
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 1.9E-07 251 493

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6765 0.7656 0.1878 0.0761 0.0818 0.075 0.0947 0.0283 0.0328 0.0141

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2311
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2196
Ophiocordyceps australis map64 (Brazil) OphauB2|5157
Ophiocordyceps camponoti-floridani Ophcf2|06507
Ophiocordyceps camponoti-rufipedis Ophun1|217
Ophiocordyceps kimflemingae Ophio5|4460
Ophiocordyceps subramaniannii Hirsu2|3096 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3096
MDQDARHEQLLDRREQLTEGLASLPYDLILYLERAVVYSDLGYPDLAAGDAYRALLLADEVANEGFEYHEQALES
LHMRTAVPVPEVLTYGSLSAMWSAADGGDSDDGEAAAHRLATIGSIRAYQILSLSLLLCGCLKSAATFCDRGLQS
APGNRELLNTQTHIRTVGRQKLRRPDFDINDLPDYGLVRREVYPWNNHEPDRFSSKSLAALNADLREMAPKCAVQ
VATLPVLLEGASETDNYSIIPTCKQLGVFAQEDIAPGEVVLREYSLLTANNRLKDVVCDACSSELPPLGSDNGPV
NCDACQDTVFCSAYCHDVAQRRYHPAVCDKDVDAIAKDPDASEADETLYFLLLARVLALAAHQAVNPLDVREVKF
IWGDFVPTRTNDINVSPNAGPPPEWTLPFSFKYNVEAPLHVLERMDVDIFASLSRYDVWILNTLYAKFRGTASAR
KNPRDGRPDVAAVHPYWCLANHDCDPNVTWDWGGRMVLWARKERVVDGRPGGIRRGDEILNHYCDISLPMQQRRE
WARGSLGGWCMCQRCRDEAAALS*
Coding >Hirsu2|3096
ATGGACCAGGATGCCCGCCACGAGCAGCTGCTCGACCGCCGCGAGCAGTTGACCGAGGGCCTCGCCAGCCTGCCC
TACGACCTGATCCTCTATCTCGAGCGCGCCGTCGTCTACTCGGACCTGGGCTATCCCGACCTCGCCGCCGGTGAC
GCCTATCGGGCCCTCCTCCTGGCCGACGAGGTCGCCAACGAGGGCTTCGAATACCACGAGCAGGCTCTCGAGAGC
CTCCACATGCGCACCGCCGTCCCGGTCCCCGAGGTCCTGACGTATGGAAGCCTGTCCGCCATGTGGTCCGCCGCC
GACGGCGGCGATTCCGACGACGGCGAGGCTGCCGCCCACCGCCTCGCCACCATCGGCTCCATCCGGGCCTACCAG
ATCCTCTCGCTGAGCCTCCTGCTCTGCGGCTGCCTCAAGAGCGCCGCCACATTCTGCGACCGCGGGCTCCAGTCC
GCGCCCGGGAACCGCGAGCTGCTCAACACCCAGACGCACATCCGGACCGTCGGCCGCCAGAAGCTGCGCCGCCCC
GACTTCGACATCAACGACCTGCCCGACTACGGCCTGGTCCGGCGCGAGGTCTATCCCTGGAACAACCACGAGCCG
GATCGCTTCTCCTCCAAGTCGCTGGCCGCCCTCAACGCCGACCTGCGGGAGATGGCGCCCAAGTGCGCCGTGCAG
GTGGCGACGCTGCCCGTCCTGCTCGAGGGCGCCAGCGAGACGGACAACTACAGCATCATCCCGACCTGCAAGCAG
CTCGGCGTCTTCGCCCAGGAGGACATCGCCCCGGGTGAGGTCGTCCTCCGTGAGTACTCGCTCCTGACGGCCAAC
AACCGGCTCAAGGACGTCGTCTGCGACGCCTGCAGCTCCGAGCTGCCCCCGCTGGGCAGCGACAACGGCCCGGTC
AACTGCGACGCCTGCCAGGACACCGTCTTCTGCAGCGCCTACTGCCACGACGTGGCCCAGCGGCGATACCACCCC
GCCGTCTGCGACAAGGACGTCGACGCCATAGCCAAGGACCCGGACGCGTCCGAGGCCGACGAGACGCTCTACTTC
CTGCTCCTGGCCCGCGTCCTGGCCCTGGCCGCGCACCAGGCCGTCAACCCGCTCGACGTGCGCGAGGTCAAGTTC
ATCTGGGGCGACTTCGTGCCGACGCGGACCAACGACATCAACGTGTCGCCCAACGCGGGCCCCCCGCCCGAGTGG
ACGCTGCCCTTCTCCTTCAAGTACAACGTCGAGGCGCCGCTGCACGTGCTCGAGCGGATGGACGTCGACATCTTC
GCCTCGCTGTCCCGGTACGACGTCTGGATCCTCAACACGCTGTACGCCAAGTTCCGCGGGACCGCCTCGGCGCGC
AAGAACCCCCGCGACGGCCGGCCCGACGTGGCCGCAGTCCACCCGTACTGGTGCCTGGCCAACCACGACTGCGAT
CCCAACGTGACCTGGGACTGGGGCGGCCGCATGGTGCTGTGGGCGCGCAAGGAGCGCGTCGTCGACGGCCGCCCG
GGCGGCATCCGTCGCGGCGACGAGATCCTCAACCACTACTGCGACATCTCGCTCCCCATGCAGCAGCGCCGGGAG
TGGGCGCGCGGCAGCCTCGGCGGCTGGTGCATGTGCCAGCGCTGCAGGGACGAGGCCGCCGCCCTGAGCTGA
Transcript >Hirsu2|3096
ATGGACCAGGATGCCCGCCACGAGCAGCTGCTCGACCGCCGCGAGCAGTTGACCGAGGGCCTCGCCAGCCTGCCC
TACGACCTGATCCTCTATCTCGAGCGCGCCGTCGTCTACTCGGACCTGGGCTATCCCGACCTCGCCGCCGGTGAC
GCCTATCGGGCCCTCCTCCTGGCCGACGAGGTCGCCAACGAGGGCTTCGAATACCACGAGCAGGCTCTCGAGAGC
CTCCACATGCGCACCGCCGTCCCGGTCCCCGAGGTCCTGACGTATGGAAGCCTGTCCGCCATGTGGTCCGCCGCC
GACGGCGGCGATTCCGACGACGGCGAGGCTGCCGCCCACCGCCTCGCCACCATCGGCTCCATCCGGGCCTACCAG
ATCCTCTCGCTGAGCCTCCTGCTCTGCGGCTGCCTCAAGAGCGCCGCCACATTCTGCGACCGCGGGCTCCAGTCC
GCGCCCGGGAACCGCGAGCTGCTCAACACCCAGACGCACATCCGGACCGTCGGCCGCCAGAAGCTGCGCCGCCCC
GACTTCGACATCAACGACCTGCCCGACTACGGCCTGGTCCGGCGCGAGGTCTATCCCTGGAACAACCACGAGCCG
GATCGCTTCTCCTCCAAGTCGCTGGCCGCCCTCAACGCCGACCTGCGGGAGATGGCGCCCAAGTGCGCCGTGCAG
GTGGCGACGCTGCCCGTCCTGCTCGAGGGCGCCAGCGAGACGGACAACTACAGCATCATCCCGACCTGCAAGCAG
CTCGGCGTCTTCGCCCAGGAGGACATCGCCCCGGGTGAGGTCGTCCTCCGTGAGTACTCGCTCCTGACGGCCAAC
AACCGGCTCAAGGACGTCGTCTGCGACGCCTGCAGCTCCGAGCTGCCCCCGCTGGGCAGCGACAACGGCCCGGTC
AACTGCGACGCCTGCCAGGACACCGTCTTCTGCAGCGCCTACTGCCACGACGTGGCCCAGCGGCGATACCACCCC
GCCGTCTGCGACAAGGACGTCGACGCCATAGCCAAGGACCCGGACGCGTCCGAGGCCGACGAGACGCTCTACTTC
CTGCTCCTGGCCCGCGTCCTGGCCCTGGCCGCGCACCAGGCCGTCAACCCGCTCGACGTGCGCGAGGTCAAGTTC
ATCTGGGGCGACTTCGTGCCGACGCGGACCAACGACATCAACGTGTCGCCCAACGCGGGCCCCCCGCCCGAGTGG
ACGCTGCCCTTCTCCTTCAAGTACAACGTCGAGGCGCCGCTGCACGTGCTCGAGCGGATGGACGTCGACATCTTC
GCCTCGCTGTCCCGGTACGACGTCTGGATCCTCAACACGCTGTACGCCAAGTTCCGCGGGACCGCCTCGGCGCGC
AAGAACCCCCGCGACGGCCGGCCCGACGTGGCCGCAGTCCACCCGTACTGGTGCCTGGCCAACCACGACTGCGAT
CCCAACGTGACCTGGGACTGGGGCGGCCGCATGGTGCTGTGGGCGCGCAAGGAGCGCGTCGTCGACGGCCGCCCG
GGCGGCATCCGTCGCGGCGACGAGATCCTCAACCACTACTGCGACATCTCGCTCCCCATGCAGCAGCGCCGGGAG
TGGGCGCGCGGCAGCCTCGGCGGCTGGTGCATGTGCCAGCGCTGCAGGGACGAGGCCGCCGCCCTGAGCTGA
Gene >Hirsu2|3096
ATGGACCAGGATGCCCGCCACGAGCAGCTGCTCGACCGCCGCGAGCAGTTGACCGAGGGCCTCGCCAGCCTGCCC
TACGACCTGATCCTCTATCTCGAGCGCGCCGTCGTCTACTCGGACCTGGGCTATCCCGACCTCGCCGCCGGTGAC
GCCTATCGGGCCCTCCTCCTGGCCGACGAGGTCGCCAACGAGGGCTTCGAATACCACGAGCAGGCTCTCGAGAGC
CTCCACATGCGCACCGCCGTCCCGGTCCCCGAGGTCCTGACGTATGGAAGCCTGTCCGCCATGTGGTCCGCCGCC
GACGGCGGCGATTCCGACGACGGCGAGGCTGCCGCCCACCGCCTCGCCACCATCGGCTCCATCCGGGCCTACCAG
ATCCTCTCGCTGAGCCTCCTGCTCTGCGGCTGCCTCAAGAGCGCCGCCACATTCTGCGACCGCGGGCTCCAGTCC
GCGCCCGGGAACCGCGAGCTGCTCAACACCCAGACGCACATCCGGACCGTCGGCCGCCAGAAGCTGCGCCGCCCC
GACTTCGACATCAACGACCTGCCCGACTACGGCCTGGTCCGGCGCGAGGTCTATCCCTGGAACAACCACGAGCCG
GATCGCTTCTCCTCCAAGTCGCTGGCCGCCCTCAACGCCGACCTGCGGGAGATGGCGCCCAAGTGCGCCGTGCAG
GTGGCGACGCTGCCCGTCCTGCTCGAGGGCGCCAGCGAGACGGACAACTACAGCATCATCCCGACCTGCAAGCAG
CTCGGCGTCTTCGCCCAGGAGGACATCGCCCCGGGTGAGGTCGTCCTCCGTGAGTACTCGCTCCTGACGGCCAAC
AACCGGCTCAAGGACGTCGTCTGCGACGCCTGCAGCTCCGAGCTGCCCCCGCTGGGCAGCGACAACGGCCCGGTC
AACTGCGACGCCTGCCAGGACACCGTCTTCTGCAGCGCCTACTGCCACGACGTGGCCCAGCGGCGATACCACCCC
GCCGTCTGCGACAAGGACGTCGACGCCATAGCCAAGGACCCGGACGCGTCCGAGGCCGACGAGACGCTCTACTTC
CTGCTCCTGGCCCGCGTCCTGGCCCTGGCCGCGCACCAGGCCGTCAACCCGCTCGACGTGCGCGAGGTCAAGTTC
ATCTGGGGCGACTTCGTGCCGACGCGGACCAACGACATCAACGTGTCGCCCAACGCGGGCCCCCCGCCCGAGTGG
ACGCTGCCCTTCTCCTTCAAGTACAACGTCGAGGCGCCGCTGCACGTGCTCGAGCGGATGGACGTCGACATCTTC
GCCTCGCTGTCCCGGTACGACGTCTGGATCCTCAACACGCTGTACGCCAAGTTCCGCGGGACCGCCTCGGCGCGC
AAGAACCCCCGCGACGGCCGGCCCGACGTGGCCGCAGTCCACCCGTACTGGTGCCTGGCCAACCACGACTGCGAT
CCCAACGTGACCTGGGACTGGGGCGGCCGCATGGTGCTGTGGGCGCGCAAGGAGCGCGTCGTCGACGGCCGCCCG
GGCGGCATCCGTCGCGGCGACGAGATCCTCAACCACTACTGCGACATCTCGCTCCCCATGCAGCAGCGCCGGGAG
TGGGCGCGCGGCAGCCTCGGCGGCTGGTGCATGTGCCAGCGCTGCAGGGACGAGGCCGCCGCCCTGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail