Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3094
Gene name
LocationContig_1790:2238..4495
Strand+
Gene length (bp)2257
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.0E-10 50 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 17 648 0.0E+00
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 682 1.0E-99
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 47 643 3.0E-89
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 15 643 7.0E-88
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 43 485 6.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 17 648 0.0E+00
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 682 1.0E-99
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 47 643 3.0E-89
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 15 643 7.0E-88
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 43 485 6.0E-78
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 43 330 6.0E-75
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 33 329 8.0E-73
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 44 330 2.0E-70
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 43 323 7.0E-59
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 16 323 2.0E-24
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 45 325 7.0E-20
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 48 327 5.0E-19
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 39 321 6.0E-18
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 46 323 1.0E-16
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 49 323 2.0E-16
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 48 323 1.0E-15
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 50 321 2.0E-15
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 48 328 6.0E-15
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 48 328 3.0E-14
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium discoideum GN=sgmD PE=3 SV=1 45 319 4.0E-14
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 48 321 6.0E-14
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 50 321 6.0E-13
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 543 690 2.0E-07
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 48 323 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3094
MTHSSTADARPWPLLLLLLSLTVAVANVVASSPAAVQAREPLRQRALTGRFLHITDFHPDALYKVHSSTKRRKAC
HRGHGMAGSYGAERTDCDSPMSLVNATFDWIARNIRDDVDFVVWTGDSARHDSDKKNKRNPAEIIESNRAVADMF
LDTFSAPGSGRLAVPVIPTFGNNDILYAHNVMKPGPNRSFRVFADIWRRFIPDDQRDAFHYGGWFYVDVIPGRLA
VFSLNTMFFFERNTAVDGCARPSEPGHRHMEWLRLELQRLRDRGMKAILMGHVPPARTGSKQNWHETCWQRYTLW
LRQYRDVVTASLFGHMNIDHFMLQDTRDLDLGGDDADEFDDEFDDDDDDEDEDDEYDEYDDDEKEDADGDAQEED
DQDVDQDATEIANGWKNRRIRPRSKGDYLQELRDEWSDLPDSIAGALADGDDEDRPALSGQRKGRKKKNKYRNIG
GKYAERYQVSLVSPSVVPNYLPTLRVFEYNTTGLEQAAVWEDPFDGQAGLPPSSPAQAPDGGDDEGEGVHVELRR
QVGAEEEEGSEGEERLVVPEGPAKESLPGPAYRLQPLTLTGYVQYFANLTYINNDVEGAGWRDGGAGGKRPKHSR
PRPRAFAYEVEYSTFDDRLYGLRDLTVRRYVHLAYRMGREEAARGAARPEPMGKKKKKDDDEEEEERNRTWLHFL
SHAFVGTMSREDLEEV*
Coding >Hirsu2|3094
ATGACGCACTCGTCAACGGCTGACGCGCGCCCCTGGCCGCTGCTGCTGCTGCTGCTGTCCCTCACCGTCGCCGTT
GCCAACGTCGTTGCATCATCGCCTGCAGCGGTCCAGGCGCGAGAGCCGCTGCGGCAGCGCGCCCTGACGGGCCGC
TTCCTGCACATCACCGACTTCCATCCCGATGCGCTCTACAAGGTGCACTCGTCGACGAAGCGGCGCAAGGCCTGC
CACCGCGGCCACGGCATGGCCGGCTCCTACGGCGCCGAGAGGACCGACTGCGACTCGCCCATGTCGCTCGTCAAC
GCCACCTTTGATTGGATCGCCCGCAACATCAGGGACGACGTCGACTTCGTCGTCTGGACCGGCGACTCGGCCCGC
CACGACAGCGACAAGAAGAACAAGCGCAATCCCGCCGAGATCATCGAGTCCAACCGCGCCGTCGCCGACATGTTC
CTCGACACCTTCTCCGCCCCCGGCTCCGGCAGGCTGGCCGTCCCCGTCATCCCCACCTTTGGCAACAACGACATC
CTCTACGCGCACAACGTCATGAAGCCCGGCCCCAACCGCTCCTTCCGCGTCTTCGCCGACATCTGGCGCCGCTTC
ATCCCCGACGACCAGCGCGACGCCTTCCACTACGGCGGCTGGTTCTACGTCGACGTCATCCCCGGCCGCCTCGCC
GTCTTCAGCCTCAACACCATGTTCTTCTTCGAGCGCAACACCGCCGTCGACGGCTGCGCCCGGCCCTCGGAGCCG
GGCCACCGCCACATGGAGTGGCTGCGCCTCGAGCTGCAGCGCCTGCGCGACCGCGGCATGAAGGCCATCCTCATG
GGCCACGTCCCGCCCGCCCGCACCGGCAGCAAGCAGAACTGGCACGAGACGTGCTGGCAGCGCTACACGCTGTGG
CTGCGCCAGTACCGCGACGTCGTCACCGCCTCCCTCTTCGGCCACATGAACATTGACCATTTTATGCTCCAAGAC
ACCCGCGACCTCGACCTGGGCGGCGACGATGCAGACGAATTCGACGACGAATTCGACGATGACGACGACGACGAA
GACGAAGACGACGAGTACGACGAATACGATGACGACGAAAAAGAAGACGCCGATGGAGATGCCCAGGAAGAAGAC
GACCAAGACGTCGATCAAGACGCCACCGAAATCGCCAACGGCTGGAAAAACCGTCGAATTCGACCGCGATCCAAG
GGAGACTACCTCCAAGAGCTGCGCGACGAGTGGTCCGACTTGCCCGACTCGATTGCGGGAGCGCTGGCAGACGGC
GACGACGAGGATCGACCTGCTCTTTCGGGCCAGAGGAAAGGGAGGAAGAAGAAGAACAAGTATCGCAACATTGGC
GGCAAGTACGCCGAGCGCTACCAAGTCTCCCTCGTCAGTCCCAGCGTCGTGCCGAACTACTTGCCGACGCTGCGG
GTCTTCGAGTACAACACGACCGGGCTCGAACAGGCGGCGGTCTGGGAGGACCCGTTCGACGGGCAAGCAGGCCTG
CCGCCGTCGAGCCCGGCCCAGGCGCCGGACGGAGGCGACGACGAGGGAGAGGGCGTGCACGTCGAGCTCAGGCGG
CAGGTCGGGGCGGAGGAGGAGGAGGGGAGCGAAGGAGAGGAGAGGCTGGTGGTGCCCGAGGGGCCGGCCAAGGAG
TCGCTGCCCGGGCCGGCGTACCGGCTGCAGCCGCTGACGCTGACGGGGTACGTGCAGTACTTTGCGAACCTCACC
TACATCAACAACGACGTCGAGGGGGCCGGGTGGCGCGACGGAGGCGCGGGCGGCAAGAGGCCCAAGCACTCGCGG
CCGCGGCCACGGGCGTTCGCGTACGAGGTCGAGTACAGCACCTTTGACGACCGGCTGTACGGGCTGCGGGACCTG
ACGGTGCGGCGATACGTGCACCTCGCGTACCGCATGGGCCGGGAGGAGGCGGCGCGGGGCGCGGCGAGGCCGGAG
CCGATGGGCAAGAAGAAGAAGAAGGACGATGACGAGGAGGAGGAGGAGAGGAACAGGACGTGGCTCCACTTCCTG
TCGCACGCCTTCGTCGGGACCATGTCGCGCGAGGACCTGGAGGAGGTGTAG
Transcript >Hirsu2|3094
ATGACGCACTCGTCAACGGCTGACGCGCGCCCCTGGCCGCTGCTGCTGCTGCTGCTGTCCCTCACCGTCGCCGTT
GCCAACGTCGTTGCATCATCGCCTGCAGCGGTCCAGGCGCGAGAGCCGCTGCGGCAGCGCGCCCTGACGGGCCGC
TTCCTGCACATCACCGACTTCCATCCCGATGCGCTCTACAAGGTGCACTCGTCGACGAAGCGGCGCAAGGCCTGC
CACCGCGGCCACGGCATGGCCGGCTCCTACGGCGCCGAGAGGACCGACTGCGACTCGCCCATGTCGCTCGTCAAC
GCCACCTTTGATTGGATCGCCCGCAACATCAGGGACGACGTCGACTTCGTCGTCTGGACCGGCGACTCGGCCCGC
CACGACAGCGACAAGAAGAACAAGCGCAATCCCGCCGAGATCATCGAGTCCAACCGCGCCGTCGCCGACATGTTC
CTCGACACCTTCTCCGCCCCCGGCTCCGGCAGGCTGGCCGTCCCCGTCATCCCCACCTTTGGCAACAACGACATC
CTCTACGCGCACAACGTCATGAAGCCCGGCCCCAACCGCTCCTTCCGCGTCTTCGCCGACATCTGGCGCCGCTTC
ATCCCCGACGACCAGCGCGACGCCTTCCACTACGGCGGCTGGTTCTACGTCGACGTCATCCCCGGCCGCCTCGCC
GTCTTCAGCCTCAACACCATGTTCTTCTTCGAGCGCAACACCGCCGTCGACGGCTGCGCCCGGCCCTCGGAGCCG
GGCCACCGCCACATGGAGTGGCTGCGCCTCGAGCTGCAGCGCCTGCGCGACCGCGGCATGAAGGCCATCCTCATG
GGCCACGTCCCGCCCGCCCGCACCGGCAGCAAGCAGAACTGGCACGAGACGTGCTGGCAGCGCTACACGCTGTGG
CTGCGCCAGTACCGCGACGTCGTCACCGCCTCCCTCTTCGGCCACATGAACATTGACCATTTTATGCTCCAAGAC
ACCCGCGACCTCGACCTGGGCGGCGACGATGCAGACGAATTCGACGACGAATTCGACGATGACGACGACGACGAA
GACGAAGACGACGAGTACGACGAATACGATGACGACGAAAAAGAAGACGCCGATGGAGATGCCCAGGAAGAAGAC
GACCAAGACGTCGATCAAGACGCCACCGAAATCGCCAACGGCTGGAAAAACCGTCGAATTCGACCGCGATCCAAG
GGAGACTACCTCCAAGAGCTGCGCGACGAGTGGTCCGACTTGCCCGACTCGATTGCGGGAGCGCTGGCAGACGGC
GACGACGAGGATCGACCTGCTCTTTCGGGCCAGAGGAAAGGGAGGAAGAAGAAGAACAAGTATCGCAACATTGGC
GGCAAGTACGCCGAGCGCTACCAAGTCTCCCTCGTCAGTCCCAGCGTCGTGCCGAACTACTTGCCGACGCTGCGG
GTCTTCGAGTACAACACGACCGGGCTCGAACAGGCGGCGGTCTGGGAGGACCCGTTCGACGGGCAAGCAGGCCTG
CCGCCGTCGAGCCCGGCCCAGGCGCCGGACGGAGGCGACGACGAGGGAGAGGGCGTGCACGTCGAGCTCAGGCGG
CAGGTCGGGGCGGAGGAGGAGGAGGGGAGCGAAGGAGAGGAGAGGCTGGTGGTGCCCGAGGGGCCGGCCAAGGAG
TCGCTGCCCGGGCCGGCGTACCGGCTGCAGCCGCTGACGCTGACGGGGTACGTGCAGTACTTTGCGAACCTCACC
TACATCAACAACGACGTCGAGGGGGCCGGGTGGCGCGACGGAGGCGCGGGCGGCAAGAGGCCCAAGCACTCGCGG
CCGCGGCCACGGGCGTTCGCGTACGAGGTCGAGTACAGCACCTTTGACGACCGGCTGTACGGGCTGCGGGACCTG
ACGGTGCGGCGATACGTGCACCTCGCGTACCGCATGGGCCGGGAGGAGGCGGCGCGGGGCGCGGCGAGGCCGGAG
CCGATGGGCAAGAAGAAGAAGAAGGACGATGACGAGGAGGAGGAGGAGAGGAACAGGACGTGGCTCCACTTCCTG
TCGCACGCCTTCGTCGGGACCATGTCGCGCGAGGACCTGGAGGAGGTGTAG
Gene >Hirsu2|3094
ATGACGCACTCGTCAACGGCTGACGCGCGCCCCTGGCCGCTGCTGCTGCTGCTGCTGTCCCTCACCGTCGCCGTT
GCCAACGTCGTTGCATCATCGCCTGCAGCGGTCCAGGCGCGAGAGCCGCTGCGGCAGCGCGCCCTGACGGGCCGC
TTCCTGCACATCACCGGTACGTTCTGCCGCGCCGTCCCTCGGCTGCGACCCTTGAGTAGACCACCACCACCACCA
CCACCGGAGGGTGTCCTCTCCTTGGTCCCCTGACGCACACAACACTCCCCTCACCTCCCACCTCGCCCTCTGCCG
CCCAATCCGAACGCGACTTTGCTCGGCTGACGCCCGCCGGCCGCCAGACTTCCATCCCGATGCGCTCTACAAGGT
GCACTCGTCGACGAAGCGGCGCAAGGCCTGCCACCGCGGCCACGGCATGGCCGGCTCCTACGGCGCCGAGAGGAC
CGACTGCGACTCGCCCATGTCGCTCGTCAACGCCACCTTTGATTGGATCGCCCGCAACATCAGGGACGACGTCGA
CTTCGTCGTCTGGACCGGCGACTCGGCCCGCCACGACAGCGACAAGAAGAACAAGCGCAATCCCGCCGAGATCAT
CGAGTCCAACCGCGCCGTCGCCGACATGTTCCTCGACACCTTCTCCGCCCCCGGCTCCGGCAGGCTGGCCGTCCC
CGTCATCCCCACCTTTGGCAACAACGACATCCTCTACGCGCACAACGTCATGAAGCCCGGCCCCAACCGCTCCTT
CCGCGTCTTCGCCGACATCTGGCGCCGCTTCATCCCCGACGACCAGCGCGACGCCTTCCACTACGGCGGCTGGTT
CTACGTCGACGTCATCCCCGGCCGCCTCGCCGTCTTCAGCCTCAACACCATGTTCTTCTTCGAGCGCAACACCGC
CGTCGACGGCTGCGCCCGGCCCTCGGAGCCGGGCCACCGCCACATGGAGTGGCTGCGCCTCGAGCTGCAGCGCCT
GCGCGACCGCGGCATGAAGGCCATCCTCATGGGCCACGTCCCGCCCGCCCGCACCGGCAGCAAGCAGAACTGGCA
CGAGACGTGCTGGCAGCGCTACACGCTGTGGCTGCGCCAGTACCGCGACGTCGTCACCGCCTCCCTCTTCGGCCA
CATGAACATTGACCATTTTATGCTCCAAGACACCCGCGACCTCGACCTGGGCGGCGACGATGCAGACGAATTCGA
CGACGAATTCGACGATGACGACGACGACGAAGACGAAGACGACGAGTACGACGAATACGATGACGACGAAAAAGA
AGACGCCGATGGAGATGCCCAGGAAGAAGACGACCAAGACGTCGATCAAGACGCCACCGAAATCGCCAACGGCTG
GAAAAACCGTCGAATTCGACCGCGATCCAAGGGAGACTACCTCCAAGAGCTGCGCGACGAGTGGTCCGACTTGCC
CGACTCGATTGCGGGAGCGCTGGCAGACGGCGACGACGAGGATCGACCTGCTCTTTCGGGCCAGAGGAAAGGGAG
GAAGAAGAAGAACAAGTATCGCAACATTGGCGGCAAGTACGCCGAGCGCTACCAAGTCTCCCTCGTCAGTCCCAG
CGTCGTGCCGAACTACTTGCCGACGCTGCGGGTCTTCGAGTACAACACGACCGGGCTCGAACAGGCGGCGGTCTG
GGAGGACCCGTTCGACGGGCAAGCAGGCCTGCCGCCGTCGAGCCCGGCCCAGGCGCCGGACGGAGGCGACGACGA
GGGAGAGGGCGTGCACGTCGAGCTCAGGCGGCAGGTCGGGGCGGAGGAGGAGGAGGGGAGCGAAGGAGAGGAGAG
GCTGGTGGTGCCCGAGGGGCCGGCCAAGGAGTCGCTGCCCGGGCCGGCGTACCGGCTGCAGCCGCTGACGCTGAC
GGGGTACGTGCAGTACTTTGCGAACCTCACCTACATCAACAACGACGTCGAGGGGGCCGGGTGGCGCGACGGAGG
CGCGGGCGGCAAGAGGCCCAAGCACTCGCGGCCGCGGCCACGGGCGTTCGCGTACGAGGTCGAGTACAGCACCTT
TGACGACCGGCTGTACGGGCTGCGGGACCTGACGGTGCGGCGATACGTGCACCTCGCGTACCGCATGGGCCGGGA
GGAGGCGGCGCGGGGCGCGGCGAGGCCGGAGCCGATGGGCAAGAAGAAGAAGAAGGACGATGACGAGGAGGAGGA
GGAGAGGAACAGGACGTGGCTCCACTTCCTGTCGCACGCCTTCGTCGGGACCATGTCGCGCGAGGACCTGGAGGA
GGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail