Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3092
Gene name
LocationContig_179:27453..30429
Strand+
Gene length (bp)2976
Transcript length (bp)2976
Coding sequence length (bp)2976
Protein length (aa) 992

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 111 988 2.0E-70
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 346 989 2.0E-67

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus 0.3583 0.2381 0.1118 0.0938 0.336 0.3631 0.2729 0.3625 0.5092 0.0908

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|68
Ophiocordyceps australis map64 (Brazil) OphauB2|5936
Ophiocordyceps camponoti-floridani Ophcf2|03959
Ophiocordyceps camponoti-rufipedis Ophun1|3841
Ophiocordyceps kimflemingae Ophio5|1733
Ophiocordyceps subramaniannii Hirsu2|3092 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3092
MGAKIKDLDTSRELEYLRKLRQSKPRITINDEEEPGEEPDILDSVLASLVFQFELRNIRMCWEVADESTDKDSTK
EDLVLSISLIEFGTRTRKSARLTIESLLLQTVPPGQDKSLRSLHSALLPEVIFNAAYVSTADARRMAFQATGESL
DLRLTSAFILPAANLAESISLSMRNVRKASAQWTGGATTSKKSDEGEGAQRQRSFFGNKRLESLLVDADFAGAVV
HVSSKTDADSPETGRRPPVGGKYGQFNADDWGSAAVLRSPGLAGKAEYRDDGKEDPSLYGEVKIDASSNILYPSV
VPLILDIMSSVKKVVGKDDDEKPPPASEAPKLKPERSAEEDNILTADPSAVIGRLKLNLGLRICRQEFSLSCQPV
ARVAAMTCFDHVYFTITTVTSHEHGNFFAISGSLSKPEASVQHVYSRESTASLGVDTVTLSFMNSKHVSGVSGMS
AILKVSPMNVSVNARQVQDFLLFREIWYPEDLRHASSAPVAKPETEMSQGYLVQRYQQVAATTAFPWTATISIAA
LDVHVDLGQAIGKLVFQIGDFWVSSKKTSDWEQNLCLGFQRIGIDATGRLSGFIALQDFRLRTSIQWPKREEALN
ETPLIQASLAFNGFRVKAAFDYQAFLIADVTSLELLMYNVRERLDGSGDRLVAIFDGESVQVFGTTASAAQGVAL
FQAMKKLVQERRENFESSLQEIEKFTRRKSNTPRPTDQASASVPRLAEDDTMAKSPISLDTDVVVTLKTLNLGVF
PSTFSDHQVFKIEALNAYARFAASMEQRRIHSVLRMTLGQLRIGLAGVRNAEGPKTLSEMTVDDVVERSTGSRGG
TILKVPRVEACMETWQSPKSNHIDYVFKSAFEGKVEVGWNYSRISYIRGLWAKHSNALEQTWGRQLPMTAVKITG
VPEAEAEQDGERQKITAEVKVPLSRYEYTALEPPIIETPQLRDMGEATPPLEWIGLHRDKLPNLTHQIVIVSLLE
LAGEVEDAYFRILGSS*
Coding >Hirsu2|3092
ATGGGCGCAAAAATAAAAGATCTGGACACGTCGCGCGAGCTCGAATATTTGAGAAAGCTGAGGCAGTCGAAGCCC
CGGATCACGATCAACGACGAAGAGGAGCCAGGGGAGGAACCCGATATATTAGACTCGGTGCTTGCCTCTCTGGTC
TTCCAGTTCGAGCTGCGAAACATCCGGATGTGCTGGGAGGTTGCAGACGAGTCAACAGACAAGGATTCCACCAAA
GAAGACCTCGTGCTCTCCATCAGCCTCATCGAATTCGGTACAAGAACGAGGAAATCGGCCAGGCTGACAATCGAA
AGCCTCCTGCTTCAAACTGTGCCGCCGGGTCAAGACAAGAGTCTGCGGTCTCTGCATTCTGCCCTCCTGCCGGAA
GTCATCTTCAATGCCGCATACGTGTCAACAGCCGACGCACGGCGTATGGCTTTCCAGGCCACTGGAGAATCACTG
GACCTGCGGCTGACATCGGCTTTCATCTTGCCTGCCGCAAACCTGGCCGAGTCCATTTCTTTGTCCATGAGAAAC
GTGCGCAAGGCTTCGGCTCAGTGGACCGGCGGGGCGACGACGTCGAAGAAGTCGGATGAAGGCGAAGGCGCTCAG
CGGCAACGAAGCTTCTTCGGAAACAAGCGATTGGAAAGCCTGCTGGTTGATGCCGACTTTGCGGGAGCGGTCGTG
CACGTTTCCAGCAAGACGGATGCTGACTCGCCCGAGACTGGCCGGCGTCCGCCAGTAGGAGGCAAATACGGCCAA
TTCAACGCGGATGACTGGGGGAGCGCGGCGGTGCTTCGCAGCCCAGGGTTGGCGGGCAAAGCCGAATACAGAGAC
GATGGAAAGGAAGATCCTTCACTGTACGGAGAGGTCAAGATCGATGCGTCTAGCAACATCTTGTACCCGTCGGTG
GTCCCTCTCATACTAGACATCATGTCAAGCGTGAAGAAGGTGGTCGGCAAAGATGACGACGAGAAGCCGCCTCCC
GCCAGCGAGGCCCCCAAGTTGAAACCGGAGAGATCGGCGGAAGAGGATAACATTCTCACCGCCGACCCAAGCGCC
GTCATAGGCCGGCTGAAGCTCAATCTTGGGCTGCGCATCTGCAGGCAAGAGTTCTCCTTGAGCTGCCAGCCGGTA
GCTCGCGTGGCGGCAATGACGTGCTTCGACCATGTCTACTTCACCATCACTACTGTAACGTCCCACGAGCACGGC
AACTTCTTCGCCATCTCCGGGTCCTTGAGCAAGCCTGAGGCCTCGGTGCAGCACGTCTACTCGAGAGAATCAACG
GCAAGCCTCGGGGTCGACACGGTGACGCTGTCGTTCATGAACAGCAAGCACGTCAGCGGCGTGAGCGGCATGTCG
GCCATCCTGAAGGTAAGCCCGATGAATGTGTCGGTCAACGCGAGGCAGGTCCAGGATTTCTTGCTGTTCCGAGAG
ATATGGTATCCCGAAGACCTGCGCCACGCGTCGTCGGCGCCGGTCGCGAAGCCGGAAACAGAGATGTCGCAGGGC
TACCTCGTCCAGCGCTATCAACAAGTGGCTGCCACGACGGCGTTCCCCTGGACAGCCACGATCTCCATCGCCGCA
CTCGACGTGCACGTCGACCTCGGCCAGGCGATCGGAAAGCTTGTCTTCCAGATCGGTGACTTCTGGGTGTCGTCG
AAAAAGACATCTGACTGGGAGCAAAATCTGTGCCTGGGATTCCAAAGGATAGGGATCGATGCCACGGGACGACTG
AGCGGCTTCATCGCGCTGCAAGACTTTAGGCTGCGAACGTCGATCCAGTGGCCGAAGCGCGAGGAGGCGCTCAAC
GAGACTCCGCTCATCCAGGCGTCGTTAGCATTCAACGGGTTCCGAGTCAAGGCGGCTTTCGACTACCAGGCGTTT
CTGATCGCCGATGTGACATCGCTCGAGCTCCTCATGTACAACGTGCGGGAGAGGCTGGACGGCAGTGGGGACCGA
CTGGTGGCCATCTTTGACGGCGAGTCGGTGCAGGTGTTTGGAACGACGGCGTCGGCGGCCCAGGGAGTGGCCCTC
TTCCAGGCGATGAAGAAGCTGGTGCAAGAACGGAGAGAGAACTTTGAGTCTTCGCTGCAAGAGATTGAGAAGTTC
ACGAGGCGGAAGTCGAACACGCCACGGCCGACGGACCAGGCGTCGGCGTCGGTGCCGAGACTGGCTGAGGACGAT
ACCATGGCCAAGTCGCCCATATCCCTGGACACGGACGTGGTCGTGACGCTCAAGACGCTGAACCTGGGCGTCTTC
CCCAGCACCTTTTCGGACCATCAAGTGTTCAAGATCGAGGCGCTAAATGCGTACGCGCGGTTCGCGGCCAGCATG
GAGCAGCGACGGATCCACAGCGTGCTGCGCATGACGCTGGGACAACTCCGCATCGGCCTGGCGGGGGTGAGAAAC
GCCGAGGGGCCCAAGACACTGAGCGAGATGACGGTGGACGACGTGGTTGAGCGGTCGACGGGATCCCGAGGGGGC
ACGATCCTCAAGGTGCCGCGGGTAGAAGCGTGTATGGAGACGTGGCAGAGCCCGAAAAGTAACCACATCGACTAC
GTGTTCAAGAGCGCGTTCGAGGGCAAGGTGGAAGTTGGATGGAACTACTCGCGCATCAGCTACATCCGCGGCCTG
TGGGCGAAGCACTCCAACGCGCTGGAGCAGACGTGGGGCCGACAGCTTCCGATGACGGCGGTCAAGATCACGGGG
GTGCCGGAGGCGGAGGCGGAGCAGGACGGCGAGCGGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCTGTCCCGG
TACGAGTACACGGCGCTGGAGCCGCCGATCATCGAGACGCCGCAGCTGCGGGACATGGGCGAGGCAACGCCGCCG
CTGGAATGGATCGGGCTGCACCGAGACAAGCTGCCGAACCTGACGCACCAGATTGTCATTGTGTCGCTGCTGGAG
CTGGCCGGCGAGGTGGAGGATGCCTACTTTCGAATCCTGGGCTCCTCCTGA
Transcript >Hirsu2|3092
ATGGGCGCAAAAATAAAAGATCTGGACACGTCGCGCGAGCTCGAATATTTGAGAAAGCTGAGGCAGTCGAAGCCC
CGGATCACGATCAACGACGAAGAGGAGCCAGGGGAGGAACCCGATATATTAGACTCGGTGCTTGCCTCTCTGGTC
TTCCAGTTCGAGCTGCGAAACATCCGGATGTGCTGGGAGGTTGCAGACGAGTCAACAGACAAGGATTCCACCAAA
GAAGACCTCGTGCTCTCCATCAGCCTCATCGAATTCGGTACAAGAACGAGGAAATCGGCCAGGCTGACAATCGAA
AGCCTCCTGCTTCAAACTGTGCCGCCGGGTCAAGACAAGAGTCTGCGGTCTCTGCATTCTGCCCTCCTGCCGGAA
GTCATCTTCAATGCCGCATACGTGTCAACAGCCGACGCACGGCGTATGGCTTTCCAGGCCACTGGAGAATCACTG
GACCTGCGGCTGACATCGGCTTTCATCTTGCCTGCCGCAAACCTGGCCGAGTCCATTTCTTTGTCCATGAGAAAC
GTGCGCAAGGCTTCGGCTCAGTGGACCGGCGGGGCGACGACGTCGAAGAAGTCGGATGAAGGCGAAGGCGCTCAG
CGGCAACGAAGCTTCTTCGGAAACAAGCGATTGGAAAGCCTGCTGGTTGATGCCGACTTTGCGGGAGCGGTCGTG
CACGTTTCCAGCAAGACGGATGCTGACTCGCCCGAGACTGGCCGGCGTCCGCCAGTAGGAGGCAAATACGGCCAA
TTCAACGCGGATGACTGGGGGAGCGCGGCGGTGCTTCGCAGCCCAGGGTTGGCGGGCAAAGCCGAATACAGAGAC
GATGGAAAGGAAGATCCTTCACTGTACGGAGAGGTCAAGATCGATGCGTCTAGCAACATCTTGTACCCGTCGGTG
GTCCCTCTCATACTAGACATCATGTCAAGCGTGAAGAAGGTGGTCGGCAAAGATGACGACGAGAAGCCGCCTCCC
GCCAGCGAGGCCCCCAAGTTGAAACCGGAGAGATCGGCGGAAGAGGATAACATTCTCACCGCCGACCCAAGCGCC
GTCATAGGCCGGCTGAAGCTCAATCTTGGGCTGCGCATCTGCAGGCAAGAGTTCTCCTTGAGCTGCCAGCCGGTA
GCTCGCGTGGCGGCAATGACGTGCTTCGACCATGTCTACTTCACCATCACTACTGTAACGTCCCACGAGCACGGC
AACTTCTTCGCCATCTCCGGGTCCTTGAGCAAGCCTGAGGCCTCGGTGCAGCACGTCTACTCGAGAGAATCAACG
GCAAGCCTCGGGGTCGACACGGTGACGCTGTCGTTCATGAACAGCAAGCACGTCAGCGGCGTGAGCGGCATGTCG
GCCATCCTGAAGGTAAGCCCGATGAATGTGTCGGTCAACGCGAGGCAGGTCCAGGATTTCTTGCTGTTCCGAGAG
ATATGGTATCCCGAAGACCTGCGCCACGCGTCGTCGGCGCCGGTCGCGAAGCCGGAAACAGAGATGTCGCAGGGC
TACCTCGTCCAGCGCTATCAACAAGTGGCTGCCACGACGGCGTTCCCCTGGACAGCCACGATCTCCATCGCCGCA
CTCGACGTGCACGTCGACCTCGGCCAGGCGATCGGAAAGCTTGTCTTCCAGATCGGTGACTTCTGGGTGTCGTCG
AAAAAGACATCTGACTGGGAGCAAAATCTGTGCCTGGGATTCCAAAGGATAGGGATCGATGCCACGGGACGACTG
AGCGGCTTCATCGCGCTGCAAGACTTTAGGCTGCGAACGTCGATCCAGTGGCCGAAGCGCGAGGAGGCGCTCAAC
GAGACTCCGCTCATCCAGGCGTCGTTAGCATTCAACGGGTTCCGAGTCAAGGCGGCTTTCGACTACCAGGCGTTT
CTGATCGCCGATGTGACATCGCTCGAGCTCCTCATGTACAACGTGCGGGAGAGGCTGGACGGCAGTGGGGACCGA
CTGGTGGCCATCTTTGACGGCGAGTCGGTGCAGGTGTTTGGAACGACGGCGTCGGCGGCCCAGGGAGTGGCCCTC
TTCCAGGCGATGAAGAAGCTGGTGCAAGAACGGAGAGAGAACTTTGAGTCTTCGCTGCAAGAGATTGAGAAGTTC
ACGAGGCGGAAGTCGAACACGCCACGGCCGACGGACCAGGCGTCGGCGTCGGTGCCGAGACTGGCTGAGGACGAT
ACCATGGCCAAGTCGCCCATATCCCTGGACACGGACGTGGTCGTGACGCTCAAGACGCTGAACCTGGGCGTCTTC
CCCAGCACCTTTTCGGACCATCAAGTGTTCAAGATCGAGGCGCTAAATGCGTACGCGCGGTTCGCGGCCAGCATG
GAGCAGCGACGGATCCACAGCGTGCTGCGCATGACGCTGGGACAACTCCGCATCGGCCTGGCGGGGGTGAGAAAC
GCCGAGGGGCCCAAGACACTGAGCGAGATGACGGTGGACGACGTGGTTGAGCGGTCGACGGGATCCCGAGGGGGC
ACGATCCTCAAGGTGCCGCGGGTAGAAGCGTGTATGGAGACGTGGCAGAGCCCGAAAAGTAACCACATCGACTAC
GTGTTCAAGAGCGCGTTCGAGGGCAAGGTGGAAGTTGGATGGAACTACTCGCGCATCAGCTACATCCGCGGCCTG
TGGGCGAAGCACTCCAACGCGCTGGAGCAGACGTGGGGCCGACAGCTTCCGATGACGGCGGTCAAGATCACGGGG
GTGCCGGAGGCGGAGGCGGAGCAGGACGGCGAGCGGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCTGTCCCGG
TACGAGTACACGGCGCTGGAGCCGCCGATCATCGAGACGCCGCAGCTGCGGGACATGGGCGAGGCAACGCCGCCG
CTGGAATGGATCGGGCTGCACCGAGACAAGCTGCCGAACCTGACGCACCAGATTGTCATTGTGTCGCTGCTGGAG
CTGGCCGGCGAGGTGGAGGATGCCTACTTTCGAATCCTGGGCTCCTCCTGA
Gene >Hirsu2|3092
ATGGGCGCAAAAATAAAAGATCTGGACACGTCGCGCGAGCTCGAATATTTGAGAAAGCTGAGGCAGTCGAAGCCC
CGGATCACGATCAACGACGAAGAGGAGCCAGGGGAGGAACCCGATATATTAGACTCGGTGCTTGCCTCTCTGGTC
TTCCAGTTCGAGCTGCGAAACATCCGGATGTGCTGGGAGGTTGCAGACGAGTCAACAGACAAGGATTCCACCAAA
GAAGACCTCGTGCTCTCCATCAGCCTCATCGAATTCGGTACAAGAACGAGGAAATCGGCCAGGCTGACAATCGAA
AGCCTCCTGCTTCAAACTGTGCCGCCGGGTCAAGACAAGAGTCTGCGGTCTCTGCATTCTGCCCTCCTGCCGGAA
GTCATCTTCAATGCCGCATACGTGTCAACAGCCGACGCACGGCGTATGGCTTTCCAGGCCACTGGAGAATCACTG
GACCTGCGGCTGACATCGGCTTTCATCTTGCCTGCCGCAAACCTGGCCGAGTCCATTTCTTTGTCCATGAGAAAC
GTGCGCAAGGCTTCGGCTCAGTGGACCGGCGGGGCGACGACGTCGAAGAAGTCGGATGAAGGCGAAGGCGCTCAG
CGGCAACGAAGCTTCTTCGGAAACAAGCGATTGGAAAGCCTGCTGGTTGATGCCGACTTTGCGGGAGCGGTCGTG
CACGTTTCCAGCAAGACGGATGCTGACTCGCCCGAGACTGGCCGGCGTCCGCCAGTAGGAGGCAAATACGGCCAA
TTCAACGCGGATGACTGGGGGAGCGCGGCGGTGCTTCGCAGCCCAGGGTTGGCGGGCAAAGCCGAATACAGAGAC
GATGGAAAGGAAGATCCTTCACTGTACGGAGAGGTCAAGATCGATGCGTCTAGCAACATCTTGTACCCGTCGGTG
GTCCCTCTCATACTAGACATCATGTCAAGCGTGAAGAAGGTGGTCGGCAAAGATGACGACGAGAAGCCGCCTCCC
GCCAGCGAGGCCCCCAAGTTGAAACCGGAGAGATCGGCGGAAGAGGATAACATTCTCACCGCCGACCCAAGCGCC
GTCATAGGCCGGCTGAAGCTCAATCTTGGGCTGCGCATCTGCAGGCAAGAGTTCTCCTTGAGCTGCCAGCCGGTA
GCTCGCGTGGCGGCAATGACGTGCTTCGACCATGTCTACTTCACCATCACTACTGTAACGTCCCACGAGCACGGC
AACTTCTTCGCCATCTCCGGGTCCTTGAGCAAGCCTGAGGCCTCGGTGCAGCACGTCTACTCGAGAGAATCAACG
GCAAGCCTCGGGGTCGACACGGTGACGCTGTCGTTCATGAACAGCAAGCACGTCAGCGGCGTGAGCGGCATGTCG
GCCATCCTGAAGGTAAGCCCGATGAATGTGTCGGTCAACGCGAGGCAGGTCCAGGATTTCTTGCTGTTCCGAGAG
ATATGGTATCCCGAAGACCTGCGCCACGCGTCGTCGGCGCCGGTCGCGAAGCCGGAAACAGAGATGTCGCAGGGC
TACCTCGTCCAGCGCTATCAACAAGTGGCTGCCACGACGGCGTTCCCCTGGACAGCCACGATCTCCATCGCCGCA
CTCGACGTGCACGTCGACCTCGGCCAGGCGATCGGAAAGCTTGTCTTCCAGATCGGTGACTTCTGGGTGTCGTCG
AAAAAGACATCTGACTGGGAGCAAAATCTGTGCCTGGGATTCCAAAGGATAGGGATCGATGCCACGGGACGACTG
AGCGGCTTCATCGCGCTGCAAGACTTTAGGCTGCGAACGTCGATCCAGTGGCCGAAGCGCGAGGAGGCGCTCAAC
GAGACTCCGCTCATCCAGGCGTCGTTAGCATTCAACGGGTTCCGAGTCAAGGCGGCTTTCGACTACCAGGCGTTT
CTGATCGCCGATGTGACATCGCTCGAGCTCCTCATGTACAACGTGCGGGAGAGGCTGGACGGCAGTGGGGACCGA
CTGGTGGCCATCTTTGACGGCGAGTCGGTGCAGGTGTTTGGAACGACGGCGTCGGCGGCCCAGGGAGTGGCCCTC
TTCCAGGCGATGAAGAAGCTGGTGCAAGAACGGAGAGAGAACTTTGAGTCTTCGCTGCAAGAGATTGAGAAGTTC
ACGAGGCGGAAGTCGAACACGCCACGGCCGACGGACCAGGCGTCGGCGTCGGTGCCGAGACTGGCTGAGGACGAT
ACCATGGCCAAGTCGCCCATATCCCTGGACACGGACGTGGTCGTGACGCTCAAGACGCTGAACCTGGGCGTCTTC
CCCAGCACCTTTTCGGACCATCAAGTGTTCAAGATCGAGGCGCTAAATGCGTACGCGCGGTTCGCGGCCAGCATG
GAGCAGCGACGGATCCACAGCGTGCTGCGCATGACGCTGGGACAACTCCGCATCGGCCTGGCGGGGGTGAGAAAC
GCCGAGGGGCCCAAGACACTGAGCGAGATGACGGTGGACGACGTGGTTGAGCGGTCGACGGGATCCCGAGGGGGC
ACGATCCTCAAGGTGCCGCGGGTAGAAGCGTGTATGGAGACGTGGCAGAGCCCGAAAAGTAACCACATCGACTAC
GTGTTCAAGAGCGCGTTCGAGGGCAAGGTGGAAGTTGGATGGAACTACTCGCGCATCAGCTACATCCGCGGCCTG
TGGGCGAAGCACTCCAACGCGCTGGAGCAGACGTGGGGCCGACAGCTTCCGATGACGGCGGTCAAGATCACGGGG
GTGCCGGAGGCGGAGGCGGAGCAGGACGGCGAGCGGCAGAAGATCACGGCCGAGGTCAAGGTGCCGCTGTCCCGG
TACGAGTACACGGCGCTGGAGCCGCCGATCATCGAGACGCCGCAGCTGCGGGACATGGGCGAGGCAACGCCGCCG
CTGGAATGGATCGGGCTGCACCGAGACAAGCTGCCGAACCTGACGCACCAGATTGTCATTGTGTCGCTGCTGGAG
CTGGCCGGCGAGGTGGAGGATGCCTACTTTCGAATCCTGGGCTCCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail