Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3091
Gene name
LocationContig_179:20783..21335
Strand+
Gene length (bp)552
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 26 147 1.0E-16
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 147 1.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3091
MSSAGDVIVARASNPLAFNSEFPAYVVICALLTIFFLLYFNRLFASIVSYAIRAITWHRYRIYIDVKALQLSLLG
GRIFFTGLRYHGSNQTFLVQHGTITWRYWLRRVREVDIRASAGPDDGVAVAKEKNAARPSRISVKLVGLEWF*
Coding >Hirsu2|3091
ATGTCTTCCGCTGGCGATGTGATCGTCGCCAGGGCCTCGAATCCCCTCGCCTTCAACTCCGAATTCCCCGCCTAC
GTCGTCATCTGCGCGCTCTTGACCATCTTCTTCCTGCTCTACTTCAACCGATTGTTTGCATCCATCGTCTCGTAT
GCCATCAGAGCCATCACTTGGCATCGGTACCGCATTTACATCGATGTCAAGGCTCTACAGCTGTCCCTCCTCGGC
GGCCGCATCTTCTTCACCGGTCTGCGATACCACGGATCCAATCAGACTTTCCTGGTGCAGCACGGCACCATAACC
TGGCGCTACTGGCTTCGTCGCGTTCGAGAGGTGGATATTCGCGCCTCGGCCGGTCCGGATGATGGCGTCGCCGTC
GCAAAAGAGAAGAATGCGGCCCGTCCATCCCGCATCAGCGTCAAGCTCGTTGGCCTGGAATGGTTTTAG
Transcript >Hirsu2|3091
ATGTCTTCCGCTGGCGATGTGATCGTCGCCAGGGCCTCGAATCCCCTCGCCTTCAACTCCGAATTCCCCGCCTAC
GTCGTCATCTGCGCGCTCTTGACCATCTTCTTCCTGCTCTACTTCAACCGATTGTTTGCATCCATCGTCTCGTAT
GCCATCAGAGCCATCACTTGGCATCGGTACCGCATTTACATCGATGTCAAGGCTCTACAGCTGTCCCTCCTCGGC
GGCCGCATCTTCTTCACCGGTCTGCGATACCACGGATCCAATCAGACTTTCCTGGTGCAGCACGGCACCATAACC
TGGCGCTACTGGCTTCGTCGCGTTCGAGAGGTGGATATTCGCGCCTCGGCCGGTCCGGATGATGGCGTCGCCGTC
GCAAAAGAGAAGAATGCGGCCCGTCCATCCCGCATCAGCGTCAAGCTCGTTGGCCTGGAATGGTTTTAG
Gene >Hirsu2|3091
ATGTCTTCCGCTGGCGATGTGATCGTCGCCAGGGCCTCGAATCCCCTCGCCTTCAACTCGTGAGTATCCAACCAC
AGGCCCGGACCCTGTTCTCCGCTGACAGTCCTTGGCACCCAGCGAATTCCCCGCCTACGTCGTCATCTGCGCGCT
CTTGACCATCTTCTTCCTGCTCTACTTCAACCGATTGTTTGCATCCATCGTCTCGTATGCCATCAGAGCCATCAC
TTGGCATCGGTACCGCATTTACATCGATGTCAAGGCTCTACAGCTGTCCCTCCTCGGCGGCCGCATCTTCTTCAC
CGGTCTGCGATACCACGGATCCAATCAGACTTTCCTGGTGCAGCACGGCACCATAACCTGGCGCTACTGGCTTCG
TCGCGTTCGAGAGGTGGATATTCGCGCCTCGGCCGGTCCGGATGATGGCGTCGCCGTCGCAAAAGAGAAGAATGC
GGCCCGTCCATCCCGCATCAGCGTCAAGCTCGTTGGCCTGGAATGGTTTGTCTATAATCGCAGCCCGGCCTACGA
CACCATTGTTGCCGGCATCGTCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail