Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3090
Gene name
LocationContig_179:18371..19975
Strand-
Gene length (bp)1604
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03619 Solute_trans_a Organic solute transporter Ostalpha 6.8E-100 15 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09906|TM184_SCHPO Transmembrane protein 184 homolog C30D11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.06c PE=1 SV=1 16 433 2.0E-116
sp|P36142|TM184_YEAST Transmembrane protein 184 homolog YKR051W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR051W PE=1 SV=1 20 359 4.0E-71
sp|Q54WM0|T1843_DICDI Transmembrane protein 184 homolog DDB_G0279555 OS=Dictyostelium discoideum GN=tmem184C PE=3 SV=1 15 314 1.0E-64
sp|Q6ZMB5|T184A_HUMAN Transmembrane protein 184A OS=Homo sapiens GN=TMEM184A PE=2 SV=1 16 314 8.0E-51
sp|Q1RMW2|T184A_BOVIN Transmembrane protein 184A OS=Bos taurus GN=TMEM184A PE=2 SV=1 16 314 1.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09906|TM184_SCHPO Transmembrane protein 184 homolog C30D11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.06c PE=1 SV=1 16 433 2.0E-116
sp|P36142|TM184_YEAST Transmembrane protein 184 homolog YKR051W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR051W PE=1 SV=1 20 359 4.0E-71
sp|Q54WM0|T1843_DICDI Transmembrane protein 184 homolog DDB_G0279555 OS=Dictyostelium discoideum GN=tmem184C PE=3 SV=1 15 314 1.0E-64
sp|Q6ZMB5|T184A_HUMAN Transmembrane protein 184A OS=Homo sapiens GN=TMEM184A PE=2 SV=1 16 314 8.0E-51
sp|Q1RMW2|T184A_BOVIN Transmembrane protein 184A OS=Bos taurus GN=TMEM184A PE=2 SV=1 16 314 1.0E-49
sp|Q3UFJ6|T184A_MOUSE Transmembrane protein 184A OS=Mus musculus GN=Tmem184a PE=2 SV=1 16 314 5.0E-47
sp|Q8BG09|T184B_MOUSE Transmembrane protein 184B OS=Mus musculus GN=Tmem184b PE=2 SV=1 10 314 8.0E-47
sp|Q4QQS1|T184A_RAT Transmembrane protein 184A OS=Rattus norvegicus GN=Tmem184a PE=2 SV=1 16 314 1.0E-46
sp|Q6GQE1|T184C_XENLA Transmembrane protein 184C OS=Xenopus laevis GN=tmem184c PE=2 SV=1 16 339 1.0E-46
sp|Q28CV2|T184C_XENTR Transmembrane protein 184C OS=Xenopus tropicalis GN=tmem184c PE=2 SV=1 16 335 4.0E-46
sp|A2VDL9|T184B_BOVIN Transmembrane protein 184B OS=Bos taurus GN=TMEM184B PE=2 SV=1 10 314 4.0E-46
sp|Q9Y519|T184B_HUMAN Transmembrane protein 184B OS=Homo sapiens GN=TMEM184B PE=1 SV=2 10 314 8.0E-46
sp|Q75JN3|T1842_DICDI Transmembrane protein 184 homolog DDB_G0276041 OS=Dictyostelium discoideum GN=tmem184B PE=3 SV=1 16 282 2.0E-45
sp|Q54PI4|T1841_DICDI Transmembrane protein 184 homolog DDB_G0284525 OS=Dictyostelium discoideum GN=tmem184A PE=3 SV=1 11 318 6.0E-45
sp|Q3TPR7|T184C_MOUSE Transmembrane protein 184C OS=Mus musculus GN=Tmem184c PE=2 SV=1 16 419 3.0E-44
sp|Q810F5|T184C_RAT Transmembrane protein 184C OS=Rattus norvegicus GN=Tmem184c PE=2 SV=1 16 324 1.0E-43
sp|Q5ZMP3|T184C_CHICK Transmembrane protein 184C OS=Gallus gallus GN=TMEM184C PE=2 SV=1 16 339 1.0E-43
sp|Q5RET6|T184C_PONAB Transmembrane protein 184C OS=Pongo abelii GN=TMEM184C PE=2 SV=1 16 310 4.0E-43
sp|Q9NVA4|T184C_HUMAN Transmembrane protein 184C OS=Homo sapiens GN=TMEM184C PE=2 SV=2 16 310 4.0E-43
sp|Q17QL9|T184C_BOVIN Transmembrane protein 184C OS=Bos taurus GN=TMEM184C PE=2 SV=1 16 337 2.0E-42
sp|Q94CA0|LAZH1_ARATH Protein LAZ1 homolog 1 OS=Arabidopsis thaliana GN=At1g77220 PE=2 SV=1 1 276 8.0E-41
sp|F4JTN2|LAZ1_ARATH Protein LAZ1 OS=Arabidopsis thaliana GN=LAZ1 PE=1 SV=1 14 276 1.0E-36
sp|Q5BPZ5|LAZH2_ARATH Protein LAZ1 homolog 2 OS=Arabidopsis thaliana GN=At1g23070 PE=2 SV=1 13 276 3.0E-34
sp|A9ULC7|OSTA_XENTR Organic solute transporter subunit alpha OS=Xenopus tropicalis GN=slc51a PE=2 SV=2 56 240 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 47 69 22
3 84 106 22
4 143 165 22
5 175 197 22
6 217 239 22
7 254 276 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3090
MGGGTGQKFTYATTVVAGVASLAATILSVVSIWLQAKNYRKPLLQRYVIRILLMVPIYSIASWASMVSSTTAAFL
DPIRDIYEAFTIYTFFQLLINFLGGERSLIIMTHGRAPVQHLWPLNHVLRTVDISDPHTFLSIKRGILQYTWLKP
ILAFAAIIMKATGTYQEGYIGLGSGYFWSGIIYNISVTVSLYSLGLFWVCMHRDLQPFRPVPKFLCIKLIIFASY
WQGFFLSILVWLGAIPDDVEGYTRDNLAAAIQDALICIEMPVFAVAHWYAFSWHDFANNNIYSARMPLNHAFRDA
FGIRDLIEDSKETFRGSNYGYRAFDSGDKVMAHEDSKSRLARLREGMRYERGGKGKYWIPKPGEINATSPLLGHH
GPNGPNGGPSSTRPDQLNESQHGTFDEPELDGDDERLFESARELEYGDWNYPVITASEPLSERYRSPSGRSSPPH
PAPGSGGRRPIGCAAAASCPD*
Coding >Hirsu2|3090
ATGGGGGGCGGGACAGGCCAGAAGTTCACCTATGCCACGACGGTGGTTGCCGGAGTCGCCTCTCTGGCAGCCACT
ATTCTGTCGGTCGTGTCAATATGGCTTCAAGCAAAGAACTATCGGAAGCCTCTCCTCCAGAGATATGTCATCCGC
ATCCTGCTCATGGTGCCCATTTACTCGATCGCCTCTTGGGCCAGCATGGTGTCGTCGACCACGGCCGCCTTCCTT
GACCCGATTCGGGACATCTATGAGGCCTTCACCATCTACACCTTCTTCCAGCTCCTCATCAACTTTCTCGGCGGA
GAGCGGTCCCTCATCATCATGACGCATGGCCGCGCACCCGTCCAGCACCTCTGGCCCCTCAATCACGTTCTTCGC
ACCGTCGACATCTCAGACCCCCACACCTTCCTCTCCATCAAGCGCGGCATTCTTCAGTACACGTGGCTCAAACCC
ATCCTCGCCTTTGCCGCCATCATCATGAAGGCGACTGGGACATACCAAGAGGGTTACATCGGCCTCGGGTCCGGC
TACTTCTGGAGCGGCATCATATACAACATCAGCGTCACCGTCAGCCTGTACTCACTCGGCTTGTTTTGGGTCTGC
ATGCACCGAGACCTGCAGCCATTCCGGCCGGTCCCCAAGTTTCTGTGCATCAAGCTCATCATCTTTGCCTCGTAC
TGGCAAGGATTCTTCTTATCTATCCTCGTTTGGCTGGGCGCCATCCCTGACGACGTCGAGGGCTACACTCGCGAC
AATCTCGCTGCCGCTATACAGGATGCTCTTATCTGCATCGAAATGCCAGTCTTCGCCGTGGCGCACTGGTACGCC
TTCTCGTGGCACGACTTCGCAAACAACAACATCTACTCGGCACGGATGCCTCTCAACCACGCCTTCCGAGACGCG
TTTGGCATCAGGGACCTGATTGAGGATTCCAAAGAAACCTTCAGAGGTAGCAACTACGGCTACCGCGCATTCGAC
TCCGGGGACAAAGTCATGGCGCACGAGGACTCCAAATCAAGACTGGCGAGGCTCCGCGAAGGAATGCGCTACGAG
AGAGGCGGAAAGGGCAAGTACTGGATACCCAAGCCGGGCGAAATCAACGCAACCTCTCCGCTGCTGGGCCATCAT
GGCCCCAATGGCCCCAACGGCGGGCCAAGCTCAACTCGACCCGACCAGTTGAACGAGAGCCAACATGGGACGTTC
GACGAACCCGAGCTCGATGGAGATGATGAGCGTCTTTTCGAGTCTGCGCGGGAGCTGGAGTATGGAGATTGGAAC
TATCCCGTCATCACCGCCAGTGAACCGCTGAGCGAACGATACCGGTCTCCCAGTGGACGCTCTTCCCCCCCGCAT
CCCGCACCCGGAAGCGGCGGCAGGCGGCCCATCGGCTGTGCAGCCGCAGCAAGTTGTCCCGATTAA
Transcript >Hirsu2|3090
ATGGGGGGCGGGACAGGCCAGAAGTTCACCTATGCCACGACGGTGGTTGCCGGAGTCGCCTCTCTGGCAGCCACT
ATTCTGTCGGTCGTGTCAATATGGCTTCAAGCAAAGAACTATCGGAAGCCTCTCCTCCAGAGATATGTCATCCGC
ATCCTGCTCATGGTGCCCATTTACTCGATCGCCTCTTGGGCCAGCATGGTGTCGTCGACCACGGCCGCCTTCCTT
GACCCGATTCGGGACATCTATGAGGCCTTCACCATCTACACCTTCTTCCAGCTCCTCATCAACTTTCTCGGCGGA
GAGCGGTCCCTCATCATCATGACGCATGGCCGCGCACCCGTCCAGCACCTCTGGCCCCTCAATCACGTTCTTCGC
ACCGTCGACATCTCAGACCCCCACACCTTCCTCTCCATCAAGCGCGGCATTCTTCAGTACACGTGGCTCAAACCC
ATCCTCGCCTTTGCCGCCATCATCATGAAGGCGACTGGGACATACCAAGAGGGTTACATCGGCCTCGGGTCCGGC
TACTTCTGGAGCGGCATCATATACAACATCAGCGTCACCGTCAGCCTGTACTCACTCGGCTTGTTTTGGGTCTGC
ATGCACCGAGACCTGCAGCCATTCCGGCCGGTCCCCAAGTTTCTGTGCATCAAGCTCATCATCTTTGCCTCGTAC
TGGCAAGGATTCTTCTTATCTATCCTCGTTTGGCTGGGCGCCATCCCTGACGACGTCGAGGGCTACACTCGCGAC
AATCTCGCTGCCGCTATACAGGATGCTCTTATCTGCATCGAAATGCCAGTCTTCGCCGTGGCGCACTGGTACGCC
TTCTCGTGGCACGACTTCGCAAACAACAACATCTACTCGGCACGGATGCCTCTCAACCACGCCTTCCGAGACGCG
TTTGGCATCAGGGACCTGATTGAGGATTCCAAAGAAACCTTCAGAGGTAGCAACTACGGCTACCGCGCATTCGAC
TCCGGGGACAAAGTCATGGCGCACGAGGACTCCAAATCAAGACTGGCGAGGCTCCGCGAAGGAATGCGCTACGAG
AGAGGCGGAAAGGGCAAGTACTGGATACCCAAGCCGGGCGAAATCAACGCAACCTCTCCGCTGCTGGGCCATCAT
GGCCCCAATGGCCCCAACGGCGGGCCAAGCTCAACTCGACCCGACCAGTTGAACGAGAGCCAACATGGGACGTTC
GACGAACCCGAGCTCGATGGAGATGATGAGCGTCTTTTCGAGTCTGCGCGGGAGCTGGAGTATGGAGATTGGAAC
TATCCCGTCATCACCGCCAGTGAACCGCTGAGCGAACGATACCGGTCTCCCAGTGGACGCTCTTCCCCCCCGCAT
CCCGCACCCGGAAGCGGCGGCAGGCGGCCCATCGGCTGTGCAGCCGCAGCAAGTTGTCCCGATTAA
Gene >Hirsu2|3090
ATGGGGGGCGGGACAGGCCAGAAGTTCACCTATGCCACGACGGTGGTTGCCGGAGTCGCCTCTCTGGCAGCCACT
ATTCTGTCGGTCGTGTACGTTGACGATGCCGCCTTCAGCAAGCTCTGGGTTCATGTGGACGCGCTAACACGGCCG
ACGCGTTGGGACAGGTCAATATGGCTTCAAGCAAAGAACTATCGGAAGCCTCTCCTCCAGAGATATGTCATCCGC
ATCCTGCTCATGGTGCCCATTTACTCGATCGCCTCTTGGGCCAGCATGGTGTCGTCGACCACGGCCGCCTTCCTT
GACCCGATTCGGGACATCTATGAGGCCTTCACCATCTACACCTTCTTCCAGCTCCTCATCAACTTTCTCGGCGGA
GAGCGGTCCCTCATCATCATGACGCATGGCCGCGCACCCGTCCAGCACCTCTGGCCCCTCAATCACGTTCTTCGC
ACCGTCGACATCTCAGACCCCCACACCTTCCTCTCCATCAAGCGCGGCATTCTTCAGTACACGTGGCTCAAACCC
ATCCTCGCCTTTGCCGCCATCATCATGAAGGCGACTGGGACATACCAAGAGGGTTACATCGGCCTCGGGTCCGGC
TACTTCTGGAGCGGCATCATATACAACATCAGCGTCACCGTCAGCCTGTACTCACTCGGCTTGTTTTGGGTCTGC
ATGCACCGAGACCTGCAGCCATTCCGGCCGGTCCCCAAGTTTCTGTGCATCAAGCTCATCATCTTTGCCTCGTAC
TGGCAAGGATTCTTCTTATCTATCCTCGTTTGGCTGGGCGCCATCCCTGACGACGTCGAGGGCTACACTCGCGAC
AATCTCGCTGCCGCTATACAGGATGCTCTTATCTGCATCGAAATGCCAGTCTTCGCCGTGGCGCACTGGTACGCC
TTCTCGTGGCACGACTTCGCAAACAACAACATCTACTCGGCACGGATGCCTCTCAACCACGCCTTCCGAGACGCG
TTTGGCATCAGGGACCTGATTGAGGATTCCAAAGAAACCTTCAGAGGTAGCAACTACGGCTACCGCGCATTCGAC
TCCGGGGACAAAGTCATGGCGCACGAGGACTCCAAATCAAGACTGGCGAGGCTCCGCGAAGGAATGCGCTACGAG
AGAGGCGGAAAGGGCAAGTACTGGATACCCAAGCCGGGCGAAATCAACGCAACCTCTCCGCTGCTGGGCCATCAT
GGCCCCAATGGCCCCAACGGCGGGCCAAGCTCAACTCGACCCGACCAGTTGAACGAGAGCCAACATGGGACGTTC
GACGAACCCGAGCTCGATGGAGATGATGAGCGTCTTTTCGAGTCTGCGCGGGAGCTGGAGTATGGAGATTGGAAC
GTGAGTACGGTCAAACCATGGCCACGAGTCGCCAGGCTAACTTTTCCTCTCCTCGAGTATCCCGTCATCACCGCC
AGTGAACCGCTGAGCGAACGATACCGGTCTCCCAGTGGAGTTCTGAGGCCAAGGGCACCCGGTCGAGGCAGCTCG
GCCTCCGTATCGCCCGGCAGCGCTCTTCCCCCCCGCATCCCGCACCCGGAAGCGGCGGCAGGCGGCCCATCGGCT
GTGCAGCCGCAGCAAGTTGTCCCGATTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail