Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|309
Gene name
LocationContig_106:5460..8607
Strand+
Gene length (bp)3147
Transcript length (bp)2745
Coding sequence length (bp)2745
Protein length (aa) 915

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.1E-36 486 693
PF06422 PDR_CDR CDR ABC transporter 1.1E-31 706 793
PF00005 ABC_tran ABC transporter 3.7E-15 162 319
PF00005 ABC_tran ABC transporter 1.3E-05 861 900
PF14510 ABC_trans_N ABC-transporter N-terminal 1.8E-17 52 136
PF13481 AAA_25 AAA domain 2.2E-07 852 899

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 42 908 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 76 908 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 76 908 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 32 908 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 49 908 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 42 908 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 76 908 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 76 908 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 32 908 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 49 908 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 26 908 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 48 910 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 79 908 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 73 908 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 85 908 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 79 908 3.0E-178
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 85 908 9.0E-178
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 149 908 1.0E-173
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 82 913 6.0E-154
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 35 913 1.0E-152
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 82 913 2.0E-152
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 80 913 9.0E-147
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 82 913 3.0E-146
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 82 913 2.0E-139
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 82 908 3.0E-139
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 74 913 1.0E-129
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 146 908 2.0E-102
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 153 908 4.0E-102
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 169 908 4.0E-97
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 150 908 4.0E-75
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 157 908 1.0E-74
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 143 908 2.0E-70
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 141 908 6.0E-68
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 143 908 4.0E-63
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 149 908 7.0E-63
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 100 908 9.0E-63
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 148 908 6.0E-62
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 148 908 9.0E-62
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 156 908 4.0E-60
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 151 908 5.0E-60
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 143 908 1.0E-59
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 147 908 1.0E-59
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 155 908 2.0E-59
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 156 908 2.0E-59
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 149 908 4.0E-59
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 141 908 6.0E-59
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 148 912 8.0E-59
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 148 908 9.0E-59
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 131 908 2.0E-58
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 148 908 2.0E-58
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 131 908 5.0E-58
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 155 779 5.0E-58
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 155 908 6.0E-58
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 155 779 7.0E-58
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 150 908 1.0E-57
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 136 908 2.0E-57
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 149 910 2.0E-57
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 141 908 1.0E-56
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 123 908 2.0E-56
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 152 908 1.0E-55
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 99 908 4.0E-55
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 152 908 6.0E-55
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 131 908 9.0E-55
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 152 908 6.0E-54
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 143 908 1.0E-53
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 151 908 2.0E-53
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 148 908 3.0E-53
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 148 908 5.0E-53
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 146 908 2.0E-52
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 148 908 1.0E-51
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 156 908 2.0E-51
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 150 908 3.0E-51
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 155 912 3.0E-51
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 147 712 6.0E-51
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 155 908 2.0E-49
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 147 712 4.0E-49
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 135 908 4.0E-49
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 104 771 2.0E-47
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 152 695 8.0E-47
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 151 908 3.0E-46
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 151 771 8.0E-46
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 144 771 4.0E-44
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 156 709 8.0E-44
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 155 704 1.0E-43
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 157 703 3.0E-43
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 154 704 8.0E-42
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 145 685 1.0E-40
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 154 801 2.0E-40
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 144 700 3.0E-40
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 154 774 5.0E-40
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 154 784 1.0E-39
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 152 711 2.0E-39
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 155 774 2.0E-39
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 154 704 7.0E-39
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 158 685 1.0E-38
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 158 681 3.0E-38
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 152 680 3.0E-38
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 157 700 5.0E-38
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 155 703 9.0E-38
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 150 768 2.0E-37
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 158 763 3.0E-37
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 154 803 8.0E-37
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 158 777 4.0E-36
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 158 702 7.0E-36
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 150 768 8.0E-36
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 158 771 9.0E-36
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 142 693 3.0E-35
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 158 693 4.0E-34
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 151 693 8.0E-33
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 159 631 9.0E-33
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 158 765 2.0E-32
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 158 763 2.0E-32
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 147 772 4.0E-32
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 150 776 7.0E-32
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 159 632 8.0E-32
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 158 685 9.0E-32
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 157 777 1.0E-31
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 153 772 1.0E-31
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 155 695 2.0E-31
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 158 706 3.0E-31
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 155 695 3.0E-31
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 155 695 4.0E-31
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 155 687 7.0E-31
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 155 706 1.0E-30
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 159 631 1.0E-30
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 155 689 1.0E-30
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 150 736 2.0E-30
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 158 700 2.0E-30
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 155 701 2.0E-30
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 158 777 4.0E-30
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 158 693 5.0E-30
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 157 765 9.0E-30
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 155 781 2.0E-29
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 158 763 3.0E-29
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 155 695 4.0E-29
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 157 406 5.0E-29
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 113 702 6.0E-29
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 155 687 7.0E-29
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 155 695 2.0E-28
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 153 706 3.0E-28
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 152 695 4.0E-28
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 155 687 5.0E-28
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 155 687 5.0E-28
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 158 593 6.0E-28
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 158 695 7.0E-28
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 168 899 1.0E-27
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 158 765 1.0E-27
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 158 695 2.0E-27
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 155 687 2.0E-27
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 155 687 2.0E-27
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 155 688 5.0E-27
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 158 695 1.0E-26
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 155 699 1.0E-26
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 155 713 1.0E-26
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 157 730 2.0E-26
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 155 687 3.0E-26
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 155 696 4.0E-26
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 158 763 5.0E-26
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 155 687 5.0E-26
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 157 405 8.0E-26
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 155 698 1.0E-25
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 158 763 1.0E-25
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 157 691 2.0E-25
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 155 687 4.0E-25
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 157 406 5.0E-25
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 157 704 6.0E-25
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 158 762 7.0E-25
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 155 691 7.0E-25
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 155 691 8.0E-25
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 158 771 1.0E-24
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 158 763 1.0E-24
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 157 691 1.0E-24
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 155 687 1.0E-24
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 155 701 2.0E-24
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 158 763 2.0E-24
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 155 713 2.0E-24
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 155 755 4.0E-24
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 155 691 4.0E-24
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 151 773 7.0E-24
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 157 730 9.0E-24
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 155 700 1.0E-23
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 153 409 2.0E-23
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 153 409 2.0E-23
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 152 687 2.0E-23
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 155 695 3.0E-23
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 155 691 4.0E-23
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 155 414 5.0E-23
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 158 405 6.0E-23
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 155 699 9.0E-23
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 155 694 1.0E-22
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 155 699 2.0E-22
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 155 746 2.0E-22
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 151 796 3.0E-22
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 145 701 1.0E-21
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 155 687 3.0E-21
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 155 695 4.0E-21
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 157 758 5.0E-21
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 158 778 1.0E-20
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 158 777 2.0E-20
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 155 700 4.0E-20
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 148 700 5.0E-20
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 151 756 8.0E-20
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 149 700 2.0E-19
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 145 424 8.0E-19
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 151 756 2.0E-18
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 158 597 3.0E-18
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 158 763 4.0E-18
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 158 773 2.0E-17
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 145 400 3.0E-17
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 155 376 4.0E-16
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 459 784 4.0E-16
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 157 401 4.0E-16
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 143 406 4.0E-16
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 157 762 5.0E-16
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 158 413 6.0E-16
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 145 414 3.0E-15
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 157 800 5.0E-15
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 155 406 4.0E-14
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 166 401 2.0E-13
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 166 406 2.0E-13
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 152 761 4.0E-12
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 158 379 5.0E-12
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 821 908 7.0E-12
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 156 401 1.0E-11
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 166 411 2.0E-11
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 153 407 2.0E-11
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 149 379 3.0E-11
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 149 379 3.0E-11
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 166 401 4.0E-11
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 155 369 6.0E-11
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 155 369 7.0E-11
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 840 908 8.0E-11
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 156 401 1.0E-10
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 157 436 1.0E-10
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 166 422 1.0E-10
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 156 401 1.0E-10
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 151 335 2.0E-10
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 155 369 3.0E-10
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 155 369 3.0E-10
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 155 369 3.0E-10
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 155 369 3.0E-10
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 156 401 3.0E-10
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 166 370 4.0E-10
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 158 369 5.0E-10
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 156 401 6.0E-10
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 158 379 6.0E-10
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 158 379 6.0E-10
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 166 426 6.0E-10
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 158 403 6.0E-10
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 158 403 8.0E-10
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 149 379 9.0E-10
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 158 379 1.0E-09
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 155 380 1.0E-09
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 159 425 1.0E-09
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 159 425 1.0E-09
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 159 425 1.0E-09
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 168 378 1.0E-09
sp|F8DT93|LOLD_ZYMMA Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=lolD PE=3 SV=1 156 372 3.0E-09
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 168 378 3.0E-09
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 166 380 3.0E-09
sp|Q0T9T7|PHNC_ECOL5 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=phnC PE=3 SV=1 157 387 4.0E-09
sp|P0DJA1|LOLD_ZYMMO Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lolD PE=3 SV=1 156 372 4.0E-09
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 166 369 5.0E-09
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 158 412 5.0E-09
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 155 369 5.0E-09
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 159 401 6.0E-09
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 166 411 6.0E-09
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 837 908 7.0E-09
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 837 908 7.0E-09
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 166 369 7.0E-09
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 155 380 7.0E-09
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 166 379 8.0E-09
sp|Q329I3|PHNC_SHIDS Phosphonates import ATP-binding protein PhnC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=phnC PE=3 SV=1 157 390 8.0E-09
sp|Q3YUN6|PHNC_SHISS Phosphonates import ATP-binding protein PhnC OS=Shigella sonnei (strain Ss046) GN=phnC PE=3 SV=1 157 387 8.0E-09
sp|Q7A169|POTA_STAAW Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MW2) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q6GAB5|POTA_STAAS Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MSSA476) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q6GHY6|POTA_STAAR Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MRSA252) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q7A679|POTA_STAAN Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain N315) GN=potA PE=1 SV=1 167 413 9.0E-09
sp|Q99V03|POTA_STAAM Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q5HGY5|POTA_STAAC Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain COL) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q2YX74|POTA_STAAB Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q2G2A7|POTA_STAA8 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain NCTC 8325) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q2FHY1|POTA_STAA3 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain USA300) GN=potA PE=3 SV=1 167 413 9.0E-09
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 156 365 1.0E-08
sp|Q8XDV7|PHNC_ECO57 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O157:H7 GN=phnC PE=3 SV=1 157 387 1.0E-08
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 155 380 1.0E-08
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 151 335 1.0E-08
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 159 425 1.0E-08
sp|Q1R3F6|PHNC_ECOUT Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain UTI89 / UPEC) GN=phnC PE=3 SV=1 157 387 1.0E-08
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 166 369 1.0E-08
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 860 914 2.0E-08
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 858 908 2.0E-08
sp|Q0K998|UGPC_CUPNH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ugpC PE=3 SV=1 156 384 2.0E-08
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 149 384 2.0E-08
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 156 384 2.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 503 702 2.0E-08
sp|O78474|ABCX_GUITH Probable ATP-dependent transporter ycf16 OS=Guillardia theta GN=ycf16 PE=3 SV=1 156 390 3.0E-08
sp|Q31TP8|PHNC_SHIBS Phosphonates import ATP-binding protein PhnC OS=Shigella boydii serotype 4 (strain Sb227) GN=phnC PE=3 SV=1 157 387 3.0E-08
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 166 380 3.0E-08
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 166 380 3.0E-08
sp|Q8FAV1|PHNC_ECOL6 Phosphonates import ATP-binding protein PhnC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=phnC PE=3 SV=1 157 390 3.0E-08
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 860 914 4.0E-08
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 479 775 4.0E-08
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 146 401 4.0E-08
sp|Q28VL7|THIQ_JANSC Thiamine import ATP-binding protein ThiQ OS=Jannaschia sp. (strain CCS1) GN=thiQ PE=3 SV=1 166 382 4.0E-08
sp|Q9AB70|PHNC_CAUCR Phosphonates import ATP-binding protein PhnC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=phnC PE=3 SV=1 166 381 4.0E-08
sp|P51241|ABCX_PORPU Probable ATP-dependent transporter ycf16 OS=Porphyra purpurea GN=ycf16 PE=3 SV=1 156 390 4.0E-08
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 840 910 5.0E-08
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 158 386 5.0E-08
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 158 379 5.0E-08
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 158 401 5.0E-08
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 166 378 6.0E-08
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 842 908 7.0E-08
sp|A0KE25|RGMG3_BURCH Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_6709 PE=3 SV=1 149 372 7.0E-08
sp|Q1BGC0|RGMG3_BURCA Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_6474 PE=3 SV=1 149 372 7.0E-08
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 158 401 7.0E-08
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 166 370 7.0E-08
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 153 384 7.0E-08
sp|Q6LV32|THIQ_PHOPR Thiamine import ATP-binding protein ThiQ OS=Photobacterium profundum GN=thiQ PE=3 SV=2 165 389 7.0E-08
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 155 434 7.0E-08
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 812 908 8.0E-08
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 166 379 8.0E-08
sp|P16677|PHNC_ECOLI Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain K12) GN=phnC PE=3 SV=2 157 387 8.0E-08
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 166 379 8.0E-08
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 159 380 9.0E-08
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 859 908 1.0E-07
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 860 914 1.0E-07
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 155 370 1.0E-07
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 158 379 1.0E-07
sp|P72297|OCCP_RHIML Octopine permease ATP-binding protein P OS=Rhizobium meliloti GN=occP PE=3 SV=1 156 379 1.0E-07
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 166 379 1.0E-07
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 166 376 1.0E-07
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 840 908 2.0E-07
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 853 908 2.0E-07
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 166 378 2.0E-07
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 166 401 2.0E-07
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 158 384 2.0E-07
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 159 401 2.0E-07
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 159 378 2.0E-07
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 157 384 2.0E-07
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 166 378 2.0E-07
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 166 378 2.0E-07
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 166 370 2.0E-07
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 426 703 3.0E-07
sp|Q3Z2Z3|POTA_SHISS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella sonnei (strain Ss046) GN=potA PE=3 SV=1 157 370 3.0E-07
sp|Q31ZK0|POTA_SHIBS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella boydii serotype 4 (strain Sb227) GN=potA PE=3 SV=1 157 370 3.0E-07
sp|Q5L5Z1|METN_CHLAB Methionine import ATP-binding protein MetN OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=metN PE=3 SV=1 158 386 3.0E-07
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 158 384 3.0E-07
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 158 384 3.0E-07
sp|P63396|Y1312_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1312c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1312c PE=3 SV=1 156 372 3.0E-07
sp|P9WQJ5|Y1281_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1281c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1281c PE=1 SV=1 156 372 3.0E-07
sp|P9WQJ4|Y1281_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1318 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1318 PE=3 SV=1 156 372 3.0E-07
sp|Q1XDP6|ABCX_PYRYE Probable ATP-dependent transporter ycf16 OS=Pyropia yezoensis GN=ycf16 PE=3 SV=1 158 390 3.0E-07
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 158 401 3.0E-07
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 166 370 3.0E-07
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 166 419 3.0E-07
sp|Q32EY4|POTA_SHIDS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=potA PE=3 SV=1 157 370 3.0E-07
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 166 386 3.0E-07
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 158 431 3.0E-07
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 149 369 3.0E-07
sp|Q0T5R2|POTA_SHIF8 Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri serotype 5b (strain 8401) GN=potA PE=3 SV=1 157 370 4.0E-07
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 149 379 4.0E-07
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 136 324 4.0E-07
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 157 378 4.0E-07
sp|P69877|POTA_SHIFL Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri GN=potA PE=3 SV=1 157 370 5.0E-07
sp|P69874|POTA_ECOLI Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain K12) GN=potA PE=1 SV=1 157 370 5.0E-07
sp|P69875|POTA_ECOL6 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potA PE=3 SV=1 157 370 5.0E-07
sp|Q0TIU8|POTA_ECOL5 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=potA PE=3 SV=1 157 370 5.0E-07
sp|P69876|POTA_ECO57 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O157:H7 GN=potA PE=3 SV=1 157 370 5.0E-07
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 166 377 5.0E-07
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 166 378 5.0E-07
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 149 369 5.0E-07
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 169 378 5.0E-07
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 855 913 6.0E-07
sp|Q1RD28|POTA_ECOUT Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain UTI89 / UPEC) GN=potA PE=3 SV=1 157 370 6.0E-07
sp|A1AA20|POTA_ECOK1 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O1:K1 / APEC GN=potA PE=3 SV=1 157 370 6.0E-07
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 157 401 6.0E-07
sp|Q83P97|PHNC_SHIFL Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri GN=phnC PE=3 SV=2 157 390 6.0E-07
sp|Q0SXV5|PHNC_SHIF8 Phosphonates import ATP-binding protein PhnC OS=Shigella flexneri serotype 5b (strain 8401) GN=phnC PE=3 SV=1 157 390 6.0E-07
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 149 384 6.0E-07
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 149 378 7.0E-07
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 158 384 8.0E-07
sp|Q5FUV5|LOLD_GLUOX Lipoprotein-releasing system ATP-binding protein LolD OS=Gluconobacter oxydans (strain 621H) GN=lolD PE=3 SV=1 130 374 8.0E-07
sp|Q160G4|HMUV_ROSDO Hemin import ATP-binding protein HmuV OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hmuV PE=3 SV=1 155 414 8.0E-07
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 827 908 9.0E-07
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 830 908 9.0E-07
sp|Q5LYN4|POTA_STRT1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=potA PE=3 SV=1 157 375 1.0E-06
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 166 379 1.0E-06
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 158 411 1.0E-06
sp|Q5M397|POTA_STRT2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=potA PE=3 SV=1 157 375 1.0E-06
sp|Q74KF8|PSTB2_LACJO Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pstB2 PE=3 SV=1 156 401 1.0E-06
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 840 908 1.0E-06
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 855 913 1.0E-06
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 158 404 1.0E-06
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 158 414 1.0E-06
sp|Q03JH1|POTA_STRTD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=potA PE=3 SV=1 157 375 1.0E-06
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 166 382 1.0E-06
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 157 378 2.0E-06
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 157 403 2.0E-06
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 166 403 2.0E-06
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 159 401 3.0E-06
sp|Q8D954|UGPC_VIBVU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain CMCP6) GN=ugpC PE=3 SV=1 159 384 3.0E-06
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 821 896 3.0E-06
sp|Q7MLB8|UGPC_VIBVY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain YJ016) GN=ugpC PE=3 SV=2 159 384 4.0E-06
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 159 384 4.0E-06
sp|Q82JY6|FBPC_STRAW Fe(3+) ions import ATP-binding protein FbpC OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fbpC PE=3 SV=1 158 390 4.0E-06
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 173 385 5.0E-06
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 153 349 5.0E-06
sp|Q8E3S6|Y1680_STRA3 Putative ABC transporter ATP-binding protein gbs1680 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1680 PE=3 SV=1 159 396 5.0E-06
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 166 401 5.0E-06
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 157 394 6.0E-06
sp|Q8XZX8|UGPC_RALSO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ralstonia solanacearum (strain GMI1000) GN=ugpC PE=3 SV=1 156 384 6.0E-06
sp|Q1GTY0|LOLD_SPHAL Lipoprotein-releasing system ATP-binding protein LolD OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lolD PE=3 SV=1 156 370 6.0E-06
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 149 379 7.0E-06
sp|Q97ZT9|PSTB_SULSO Phosphate import ATP-binding protein PstB OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pstB PE=3 SV=1 158 406 7.0E-06
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 157 379 8.0E-06
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 156 390 8.0E-06
sp|Q8DY60|Y1633_STRA5 Putative ABC transporter ATP-binding protein SAG1633 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1633 PE=3 SV=1 159 396 9.0E-06
sp|Q2IF17|LOLD_ANADE Lipoprotein-releasing system ATP-binding protein LolD OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lolD PE=3 SV=1 153 376 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 504 526 22
2 538 560 22
3 580 602 22
4 615 637 22
5 642 664 22
6 755 777 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|309
MSRPAGGGTSNGSGRESAPTSPVLSSETASTADSGSGGLEHQQARIDEHVHELARRLTSTQSQGGGRGSLFPLPA
NGPLDPSSADFDARKWTRAFYNLRRDALEGNPPKTTGVAFANLSAYGFGTGADFQKSVGNVALEAGALAKKLLLR
RRPPRVEILHGLEGVVRSGQMVAVLGPPGSGCSTFLKTVAGDTHGFHVGPDSTINYQGIHPGQMRSAFRGEAVYT
AEVDHHFPHLTVGDTLYFAARARCPRTIPPGVSRREYVEHLRDVTMNLFGIAHTRHTRVGDDFVRGVSGGERKRV
TIAEAALSYSPLQCWDNSTRGLDSANAIEFCRTLRTQADVMGCTSFVAIYQAPQDAYDLFDKVLLLYQGRQIYFG
PASEAKAFFEHLGFDCPEQQTTADFLTSMTSPSERVVRPGWEARTPRTPDDFARAWRESRQRARLMDELDHYLDA
HPFHGDDYDRFSRTRRMDQSGLQRHKSPYTLRYTEQLALTLWRSFVMLRTDPSLTVTMLITNLFEALMISSIFYN
LPETTASLDRRGLLIFFTMMINAFGSMLEIMTLYAKRNIVEKHARYALYHPSAEALASMIADLPYKVVNAIIINT
ILYFMGNLRREPGPYFFFLLVSFTTALCMSMLFRLIGSTTKSIAQALAPASIILLGLALYTGYIIPPQYMRGWIS
WARWVDPLFYSLEAAMLNDLVGRDFPCSSFIPSGPDYESVAPAERACSVQGSVPGRDTVSGEAYLAATFGYGASH
RWRNFGILVAFLLAYMGLHLLATEYIAGERSKGEVLVFSRKAMAGRRRRKQLEGASGDEESGGGDGKARPAQQDA
IQTEEKVADVERQRSIFHWRNVCYDIKIKGEPRRILDHVDGWVRPGTLTALMGASGAGKTTLLDVLASRVTTGVV
TGDMLVDGTLAEIG*
Coding >Hirsu2|309
ATGTCCAGGCCCGCAGGAGGAGGCACGAGCAACGGCTCCGGGCGGGAGTCGGCGCCGACGTCGCCCGTCCTGTCG
AGCGAGACGGCCTCGACGGCGGACTCGGGCTCGGGCGGGCTCGAGCACCAGCAGGCGCGGATCGATGAGCACGTC
CATGAGCTGGCGCGGCGGCTCACGTCGACGCAGTCGCAGGGCGGCGGGCGCGGCTCGCTGTTCCCGCTGCCGGCG
AACGGGCCGCTGGACCCGAGCAGCGCCGACTTCGACGCCCGGAAGTGGACGCGGGCCTTCTACAACCTCCGCCGG
GACGCGCTCGAGGGCAACCCGCCCAAGACGACGGGGGTGGCGTTCGCGAACCTCAGCGCCTACGGCTTCGGCACC
GGCGCCGACTTCCAGAAGAGCGTGGGCAACGTGGCGCTCGAGGCCGGGGCGCTGGCCAAGAAGCTGCTGCTGCGC
CGGCGGCCGCCGCGGGTCGAGATCCTGCACGGGCTCGAGGGCGTCGTCCGCAGCGGCCAGATGGTCGCCGTCCTC
GGCCCGCCCGGCTCCGGCTGCTCCACCTTCCTCAAGACGGTGGCCGGCGACACGCACGGCTTCCACGTCGGCCCG
GACTCGACCATCAACTACCAGGGCATCCACCCGGGCCAGATGCGGTCGGCCTTCCGCGGCGAGGCCGTCTATACG
GCCGAGGTCGACCACCACTTCCCGCACCTGACCGTCGGCGACACGCTGTACTTCGCCGCCCGGGCCCGGTGCCCG
CGCACCATCCCGCCGGGCGTCTCGCGCCGCGAGTACGTCGAGCACCTGCGCGACGTCACCATGAACCTCTTCGGC
ATCGCCCACACCCGCCACACGCGCGTCGGCGACGACTTCGTCCGCGGCGTCAGCGGCGGCGAGCGCAAGCGCGTC
ACCATCGCCGAGGCCGCCCTGAGCTACTCGCCGCTGCAGTGCTGGGACAACAGCACGCGCGGCCTCGACAGCGCC
AACGCCATCGAGTTCTGCCGCACCCTGCGCACCCAGGCCGACGTCATGGGCTGCACCTCCTTCGTCGCCATCTAT
CAGGCGCCCCAGGATGCCTATGATCTCTTCGACAAGGTCCTCCTCCTCTACCAGGGCCGGCAGATCTACTTCGGT
CCGGCGTCCGAGGCCAAGGCCTTCTTCGAGCACCTCGGCTTCGACTGCCCGGAGCAGCAGACGACGGCCGACTTC
CTAACCTCGATGACCAGTCCGTCCGAGCGCGTCGTCCGCCCCGGCTGGGAGGCCCGGACGCCCCGGACGCCCGAC
GACTTCGCCCGGGCCTGGCGCGAGAGCCGCCAGCGGGCGCGCCTAATGGACGAGCTGGACCACTACCTCGACGCC
CATCCCTTCCACGGCGACGACTACGACCGCTTCTCTCGCACCAGGCGCATGGACCAGTCCGGCCTGCAGCGCCAC
AAGTCGCCCTACACCCTTCGCTACACCGAGCAGCTGGCCCTGACGCTCTGGCGCAGCTTCGTCATGCTCCGGACC
GACCCCAGCCTGACCGTCACGATGCTCATCACCAACCTATTCGAGGCCCTGATGATCAGCAGCATCTTCTACAAC
TTGCCCGAGACGACGGCCAGCCTCGACCGCCGCGGCCTGCTCATTTTCTTCACCATGATGATCAACGCCTTCGGC
AGCATGCTCGAGATCATGACGCTGTACGCCAAACGCAACATCGTCGAGAAGCACGCTCGCTATGCCCTCTACCAC
CCTAGCGCCGAGGCCTTGGCGTCCATGATCGCCGACCTCCCGTATAAGGTCGTCAACGCCATCATCATCAACACC
ATACTCTACTTCATGGGCAACCTCCGTCGCGAGCCCGGGCCCTACTTTTTCTTCCTCCTCGTCAGCTTCACGACC
GCCCTCTGCATGTCCATGCTGTTCCGCCTCATCGGCTCGACCACCAAGTCCATCGCCCAGGCCCTGGCCCCGGCC
TCTATCATCCTGCTCGGCCTCGCCCTCTACACCGGCTACATCATCCCGCCCCAGTACATGCGAGGCTGGATCTCC
TGGGCCCGCTGGGTCGACCCCCTCTTCTACAGCCTCGAGGCCGCCATGCTCAACGACCTCGTCGGCCGCGACTTC
CCCTGCTCCAGCTTCATCCCGTCCGGCCCAGACTACGAGTCCGTTGCGCCCGCCGAGCGGGCCTGCTCCGTCCAG
GGCTCCGTCCCCGGCCGGGACACCGTCAGCGGCGAGGCCTACCTGGCCGCCACGTTCGGCTACGGCGCTTCTCAC
CGCTGGCGCAACTTTGGCATCCTCGTCGCCTTCCTCCTCGCCTACATGGGCCTGCACCTCCTCGCCACCGAATAC
ATCGCCGGGGAGCGCTCCAAGGGCGAGGTCCTCGTCTTTAGCCGCAAGGCCATGGCCGGCCGTCGACGCCGGAAG
CAGCTCGAGGGCGCATCCGGCGACGAGGAATCCGGCGGCGGCGACGGCAAGGCTCGGCCGGCCCAGCAGGACGCC
ATTCAGACCGAAGAGAAGGTGGCTGACGTCGAGAGGCAGAGATCCATATTCCACTGGAGGAATGTCTGCTACGAC
ATCAAGATCAAGGGAGAGCCCAGGCGGATCCTGGACCACGTCGATGGCTGGGTCAGGCCCGGTACCCTAACGGCG
TTGATGGGGGCCTCAGGGGCTGGAAAGACGACTCTGCTCGACGTCCTCGCCAGCCGTGTCACCACTGGCGTTGTG
ACCGGCGACATGCTGGTCGACGGTACTCTCGCAGAGATAGGCTAG
Transcript >Hirsu2|309
ATGTCCAGGCCCGCAGGAGGAGGCACGAGCAACGGCTCCGGGCGGGAGTCGGCGCCGACGTCGCCCGTCCTGTCG
AGCGAGACGGCCTCGACGGCGGACTCGGGCTCGGGCGGGCTCGAGCACCAGCAGGCGCGGATCGATGAGCACGTC
CATGAGCTGGCGCGGCGGCTCACGTCGACGCAGTCGCAGGGCGGCGGGCGCGGCTCGCTGTTCCCGCTGCCGGCG
AACGGGCCGCTGGACCCGAGCAGCGCCGACTTCGACGCCCGGAAGTGGACGCGGGCCTTCTACAACCTCCGCCGG
GACGCGCTCGAGGGCAACCCGCCCAAGACGACGGGGGTGGCGTTCGCGAACCTCAGCGCCTACGGCTTCGGCACC
GGCGCCGACTTCCAGAAGAGCGTGGGCAACGTGGCGCTCGAGGCCGGGGCGCTGGCCAAGAAGCTGCTGCTGCGC
CGGCGGCCGCCGCGGGTCGAGATCCTGCACGGGCTCGAGGGCGTCGTCCGCAGCGGCCAGATGGTCGCCGTCCTC
GGCCCGCCCGGCTCCGGCTGCTCCACCTTCCTCAAGACGGTGGCCGGCGACACGCACGGCTTCCACGTCGGCCCG
GACTCGACCATCAACTACCAGGGCATCCACCCGGGCCAGATGCGGTCGGCCTTCCGCGGCGAGGCCGTCTATACG
GCCGAGGTCGACCACCACTTCCCGCACCTGACCGTCGGCGACACGCTGTACTTCGCCGCCCGGGCCCGGTGCCCG
CGCACCATCCCGCCGGGCGTCTCGCGCCGCGAGTACGTCGAGCACCTGCGCGACGTCACCATGAACCTCTTCGGC
ATCGCCCACACCCGCCACACGCGCGTCGGCGACGACTTCGTCCGCGGCGTCAGCGGCGGCGAGCGCAAGCGCGTC
ACCATCGCCGAGGCCGCCCTGAGCTACTCGCCGCTGCAGTGCTGGGACAACAGCACGCGCGGCCTCGACAGCGCC
AACGCCATCGAGTTCTGCCGCACCCTGCGCACCCAGGCCGACGTCATGGGCTGCACCTCCTTCGTCGCCATCTAT
CAGGCGCCCCAGGATGCCTATGATCTCTTCGACAAGGTCCTCCTCCTCTACCAGGGCCGGCAGATCTACTTCGGT
CCGGCGTCCGAGGCCAAGGCCTTCTTCGAGCACCTCGGCTTCGACTGCCCGGAGCAGCAGACGACGGCCGACTTC
CTAACCTCGATGACCAGTCCGTCCGAGCGCGTCGTCCGCCCCGGCTGGGAGGCCCGGACGCCCCGGACGCCCGAC
GACTTCGCCCGGGCCTGGCGCGAGAGCCGCCAGCGGGCGCGCCTAATGGACGAGCTGGACCACTACCTCGACGCC
CATCCCTTCCACGGCGACGACTACGACCGCTTCTCTCGCACCAGGCGCATGGACCAGTCCGGCCTGCAGCGCCAC
AAGTCGCCCTACACCCTTCGCTACACCGAGCAGCTGGCCCTGACGCTCTGGCGCAGCTTCGTCATGCTCCGGACC
GACCCCAGCCTGACCGTCACGATGCTCATCACCAACCTATTCGAGGCCCTGATGATCAGCAGCATCTTCTACAAC
TTGCCCGAGACGACGGCCAGCCTCGACCGCCGCGGCCTGCTCATTTTCTTCACCATGATGATCAACGCCTTCGGC
AGCATGCTCGAGATCATGACGCTGTACGCCAAACGCAACATCGTCGAGAAGCACGCTCGCTATGCCCTCTACCAC
CCTAGCGCCGAGGCCTTGGCGTCCATGATCGCCGACCTCCCGTATAAGGTCGTCAACGCCATCATCATCAACACC
ATACTCTACTTCATGGGCAACCTCCGTCGCGAGCCCGGGCCCTACTTTTTCTTCCTCCTCGTCAGCTTCACGACC
GCCCTCTGCATGTCCATGCTGTTCCGCCTCATCGGCTCGACCACCAAGTCCATCGCCCAGGCCCTGGCCCCGGCC
TCTATCATCCTGCTCGGCCTCGCCCTCTACACCGGCTACATCATCCCGCCCCAGTACATGCGAGGCTGGATCTCC
TGGGCCCGCTGGGTCGACCCCCTCTTCTACAGCCTCGAGGCCGCCATGCTCAACGACCTCGTCGGCCGCGACTTC
CCCTGCTCCAGCTTCATCCCGTCCGGCCCAGACTACGAGTCCGTTGCGCCCGCCGAGCGGGCCTGCTCCGTCCAG
GGCTCCGTCCCCGGCCGGGACACCGTCAGCGGCGAGGCCTACCTGGCCGCCACGTTCGGCTACGGCGCTTCTCAC
CGCTGGCGCAACTTTGGCATCCTCGTCGCCTTCCTCCTCGCCTACATGGGCCTGCACCTCCTCGCCACCGAATAC
ATCGCCGGGGAGCGCTCCAAGGGCGAGGTCCTCGTCTTTAGCCGCAAGGCCATGGCCGGCCGTCGACGCCGGAAG
CAGCTCGAGGGCGCATCCGGCGACGAGGAATCCGGCGGCGGCGACGGCAAGGCTCGGCCGGCCCAGCAGGACGCC
ATTCAGACCGAAGAGAAGGTGGCTGACGTCGAGAGGCAGAGATCCATATTCCACTGGAGGAATGTCTGCTACGAC
ATCAAGATCAAGGGAGAGCCCAGGCGGATCCTGGACCACGTCGATGGCTGGGTCAGGCCCGGTACCCTAACGGCG
TTGATGGGGGCCTCAGGGGCTGGAAAGACGACTCTGCTCGACGTCCTCGCCAGCCGTGTCACCACTGGCGTTGTG
ACCGGCGACATGCTGGTCGACGGTACTCTCGCAGAGATAGGCTAG
Gene >Hirsu2|309
ATGTCCAGGCCCGCAGGAGGAGGCACGAGCAACGGCTCCGGGCGGGAGTCGGCGCCGACGTCGCCCGTCCTGTCG
AGCGAGACGGCCTCGACGGCGGACTCGGGCTCGGGCGGGCTCGAGCACCAGCAGGCGCGGATCGATGAGCACGTC
CATGAGCTGGCGCGGCGGCTCACGTCGACGCAGTCGCAGGGCGGCGGGCGCGGCTCGCTGTTCCCGCTGCCGGCG
AACGGGCCGCTGGACCCGAGCAGCGCCGACTTCGACGCCCGGAAGTGGACGCGGGCCTTCTACAACCTCCGCCGG
GACGCGCTCGAGGGCAACCCGCCCAAGACGACGGGGGTGGCGTTCGCGAACCTCAGCGCCTACGGCTTCGGCACC
GGCGCCGACTTCCAGAAGAGCGTGGGCAACGTGGCGCTCGAGGCCGGGGCGCTGGCCAAGAAGCTGCTGCTGCGC
CGGCGGCCGCCGCGGGTCGAGATCCTGCACGGGCTCGAGGGCGTCGTCCGCAGCGGCCAGATGGTCGCCGTCCTC
GGCCCGCCCGGCTCCGGCTGCTCCACCTTCCTCAAGACGGTGGCCGGCGACACGCACGGCTTCCACGTCGGCCCG
GACTCGACCATCAACTACCAGGGCATCCACCCGGGCCAGATGCGGTCGGCCTTCCGCGGCGAGGCCGTCTATACG
GCCGAGGTCGACCACCACTTCCCGCACCTGACCGTCGGCGACACGCTGTACTTCGCCGCCCGGGCCCGGTGCCCG
CGCACCATCCCGCCGGGCGTCTCGCGCCGCGAGTACGTCGAGCACCTGCGCGACGTCACCATGAACCTCTTCGGC
ATCGCCCACACCCGCCACACGCGCGTCGGCGACGACTTCGTCCGCGGCGTCAGCGGCGGCGAGCGCAAGCGCGTC
ACCATCGCCGAGGCCGCCCTGAGCTACTCGCCGCTGCAGTGCTGGGACAACAGCACGCGCGGCCTCGACAGCGCC
AACGCCATCGAGTTCTGCCGCACCCTGCGCACCCAGGCCGACGTCATGGGCTGCACCTCCTTCGTCGCCATCTAT
CAGGCGCCCCAGGATGCCTATGATGTGAGTTCGAGCTGTGCCCCGGGTCTCCCTCCCCCCCCTGAGCCTACCCCC
TGAGTCCGTCCCCCCCTGAGCCCCCTGAGTCGAGAAAGAAGAGAAAGAGAGAAAAGGGCGGTTCTCGTTCTGTTC
TCGCCGCGGCCTCGGATCAGACTGACCCGCGTTTCGCAATGTTGCCACCACCAGCTCTTCGACAAGGTCCTCCTC
CTCTACCAGGGCCGGCAGATCTACTTCGGTCCGGCGTCCGAGGCCAAGGCCTTCTTCGAGCACCTCGGCTTCGAC
TGCCCGGAGCAGCAGACGACGGCCGACTTCCTAACCTCGATGACCAGTCCGTCCGAGCGCGTCGTCCGCCCCGGC
TGGGAGGCCCGGACGCCCCGGACGCCCGACGACTTCGCCCGGGCCTGGCGCGAGAGCCGCCAGCGGGCGCGCCTA
ATGGACGAGCTGGACCACTACCTCGACGCCCATCCCTTCCACGGCGACGACTACGACCGCTTCTCTCGCACCAGG
CGCATGGACCAGTCCGGCCTGCAGCGCCACAAGTCGCCCTACACCCTTCGCTACACCGAGCAGCTGGCCCTGACG
CTCTGGCGCAGCTTCGTCATGCTCCGGACCGACCCCAGCCTGACCGTCACGATGCTCATCACCAACCTATTCGAG
GCCCTGATGATCAGCAGCATCTTCTACAACTTGCCCGAGACGACGGCCAGCCTCGACCGCCGCGGCCTGCTCATT
TTCTTCACCATGATGATCAACGCCTTCGGCAGCATGCTCGAGATCATGACGCTGTACGCCAAACGCAACATCGTC
GAGAAGCACGCTCGCTATGCCCTCTACCACCCTAGCGCCGAGGCCTTGGCGTCCATGATCGCCGACCTCCCGTAT
AAGGTCGTCAACGCCATCATCATCAACACCATACTCTACTTCATGGGCAACCTCCGTCGCGAGCCCGGGCCCTAC
TTTTTCTTCCTCCTCGTCAGCTTCACGACCGCCCTCTGCATGTCCATGCTGTTCCGCCTCATCGGCTCGACCACC
AAGTCCATCGCCCAGGCCCTGGCCCCGGCCTCTATCATCCTGCTCGGCCTCGCCCTCTACACCGGCTACATCATC
CCGCCCCAGTACATGCGAGGCTGGATCTCCTGGGCCCGCTGGGTCGACCCCCTCTTCTACAGCCTCGAGGCCGCC
ATGCTCAACGACCTCGTCGGCCGCGACTTCCCCTGCTCCAGCTTCATCCCGTCCGGCCCAGACTACGAGTCCGTT
GCGCCCGCCGAGCGGGCCTGCTCCGTCCAGGGCTCCGTCCCCGGCCGGGACACCGTCAGCGGCGAGGCCTACCTG
GCCGCCACGTTCGGCTACGGCGCTTCTCACCGCTGGCGCAACTTTGGCATCCTCGTCGCCTTCCTCCTCGCCTAC
ATGGGCCTGCACCTCCTCGCCACCGAATACATCGCCGGGGAGCGCTCCAAGGGCGAGGTCCTCGTCTTTAGCCGC
AAGGCCATGGCCGGCCGTCGACGCCGGAAGCAGCTCGAGGGCGCATCCGGCGACGAGGAATCCGGCGGCGGCGAC
GGCAAGGCTCGGCCGGCCCAGCAGGACGCCATTCAGACCGAAGAGAAGGTGGCTGACGTCGAGAGGCAGAGATCC
ATATTCCACTGGAGGAATGTCTGCTACGACATCAAGATCAAGGGAGAGCCCAGGCGGATCCTGGACCACGTCGAT
GGCTGGGTCAGGCCCGGTACCCTAACGGCGTTGATGGTAAGTACATGCAGACTCGTCATCTCTTCCTCCTCGTCA
TAGCGATTAGGAAAGGGGATACGATGGATGGACTGACACGCGCTCCTTTCTTGATGCAGGGGGCCTCAGGGGCTG
GAAAGACGACTCTGCTCGACGTCCTCGCCAGCCGTGTCACCACTGGCGTTGTGACCGGCGACATGCTGGTCGACG
GTAAGCTGCGGGACGAATCGTTCCAGCGCAAAACGGGTTATGCCCAGCAGCAAGATCTCCATCTCGCAACCTCGA
CGGTTCGCGAAGCCCTTAATTTTAGTGCCCTCTTACGCCAACCGCCTAGGTACTCTCGCAGAGATAGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail