Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3089
Gene name
LocationContig_179:15168..17849
Strand+
Gene length (bp)2681
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 8.5E-136 281 756
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 3.0E-48 32 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 9 773 3.0E-100
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 39 792 4.0E-51

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3089
MVRCGVLALPLAAAVASVANALDLSKYALTDTGSINGGNTFPGVSRPLGMVKLGPDLDTGRDSYSGYQPAGTFTG
FSMLHESGTGGAPKYGVVSQMPVVGVVMNPLSDVTSVDRAEPDFTEVGYYRAKPASGVTVELAAASRAGMYNYTF
PWGRQGSHVLVDVSHVLSSYRGQGLEQHYLGGNITVRGDGNGSSGLYYTGFGRYDNGWNRAGPWTVYFCGHFDVP
ATYRTFLGADNSSDKLAEFSTKPSYESDSARLGALFTFNQTQVVSRVGVSFVSVDQACSNVEREIPRDTQLSTVR
QQTRDAWDSTVFSKVTTTETNTTKLNQLYSALYFMHLIPTNKTGENPLWESEEPYYDDIFTFWDTYRCTTALFHV
LQPESYEELLRSMIDIFRHQGWISDGRSSFYNGAVQGGSNGDNVLADAFVKGVRGKVNWDDAFAAMVKNALVVPP
NNNDPRDPTGSTKEGRGALPDWLKYGYITPRFSRSVSRAVEYSVNDFSLAVVAAGQGRWSDYLTYSRRSLNWRNH
WNANMTALGFSGFVGPRDSTGFLPQDPLSCGGCYWGDYYYQGLPWEYSFNAHHDLAHLVRLCGGPDAFVRRLEMT
FTPGVYSGNADFGHTLFNPGNEPSFTTPYLYNYVNRQDLAVKRSRAVAKSYYRPTPDGLPGNSDAGAMESWLLWN
MIGLYPMTGQPVFLIGSPWLSNLTIDLGRGKQLRVESSGGGGDDDAFYVQSLRVNGQPWNRSWLTWHDVFADGGT
LQFVLGSNPANWTTGPPPPSLASLGPYEAKDLLQNLVRPQPGTQIVL*
Coding >Hirsu2|3089
ATGGTACGGTGTGGTGTTCTTGCGTTGCCTCTGGCAGCGGCCGTCGCGTCAGTCGCGAATGCGCTTGACCTGTCC
AAGTATGCCTTGACCGACACCGGCTCTATCAACGGAGGCAACACCTTTCCCGGCGTGTCTCGGCCGCTGGGCATG
GTCAAGCTCGGACCGGATCTAGACACCGGAAGGGACTCTTACTCGGGTTATCAGCCCGCCGGCACCTTCACCGGC
TTCTCCATGCTCCACGAGAGCGGCACTGGCGGAGCTCCCAAGTACGGCGTGGTGTCACAGATGCCGGTGGTGGGA
GTCGTCATGAACCCCCTGAGCGATGTCACCAGTGTCGACCGCGCCGAGCCCGACTTCACAGAGGTCGGCTACTAC
CGGGCGAAGCCGGCCTCAGGTGTGACGGTGGAGCTGGCTGCCGCCTCGAGGGCTGGCATGTATAATTATACCTTT
CCCTGGGGCAGGCAGGGCTCCCACGTCCTCGTCGACGTTTCCCACGTCCTGTCGTCCTACCGCGGTCAGGGCCTG
GAACAACACTACCTCGGAGGCAACATCACCGTACGAGGGGACGGGAACGGCTCCAGCGGCCTGTACTACACCGGC
TTCGGCCGCTACGACAACGGATGGAATCGAGCTGGCCCGTGGACCGTCTATTTCTGCGGACATTTTGACGTCCCG
GCCACGTACCGCACGTTTCTCGGTGCCGACAACTCTAGTGACAAGCTGGCCGAGTTTTCGACCAAACCGAGTTAT
GAGTCCGACTCTGCCCGGCTCGGGGCGCTCTTCACCTTCAACCAGACCCAGGTCGTCTCCCGGGTCGGTGTCTCG
TTCGTGTCCGTGGACCAGGCCTGTTCCAACGTCGAGCGTGAGATCCCACGAGACACGCAGTTGAGTACAGTCCGG
CAGCAAACCCGCGACGCCTGGGACTCGACCGTGTTCTCCAAAGTGACGACGACGGAAACCAACACAACCAAGCTC
AACCAACTCTACTCTGCCCTGTACTTCATGCACCTCATTCCGACAAACAAGACGGGCGAAAATCCTCTGTGGGAG
TCCGAGGAGCCGTATTACGATGACATTTTCACCTTCTGGGACACGTATCGCTGTACGACAGCTCTGTTTCACGTG
CTACAGCCGGAATCGTATGAAGAACTCTTGAGGTCTATGATCGACATCTTCCGTCACCAAGGCTGGATCTCGGAC
GGCCGCTCGTCCTTTTACAACGGCGCTGTTCAGGGCGGCTCCAACGGCGACAACGTCCTTGCCGATGCCTTCGTC
AAGGGAGTCAGGGGCAAGGTCAACTGGGACGACGCGTTCGCGGCCATGGTCAAGAACGCACTGGTCGTGCCGCCC
AACAACAACGACCCGCGCGACCCTACTGGCTCGACCAAGGAGGGCCGAGGCGCGCTGCCCGACTGGCTGAAGTAC
GGCTACATCACACCCAGGTTCTCCCGCTCCGTCAGCCGAGCCGTCGAGTACTCCGTCAACGACTTCTCCCTGGCC
GTCGTCGCCGCCGGTCAAGGCCGATGGTCCGACTACCTCACGTACTCGCGGCGGTCGCTCAACTGGCGCAACCAC
TGGAACGCCAACATGACGGCCCTGGGCTTCTCCGGCTTCGTCGGCCCTCGGGATAGCACCGGGTTCCTCCCGCAG
GACCCCCTGTCCTGCGGCGGCTGCTACTGGGGCGACTACTACTACCAGGGCCTGCCGTGGGAGTACTCCTTCAAT
GCGCACCACGACCTGGCGCACCTCGTCAGGCTGTGCGGCGGGCCCGACGCCTTCGTCCGCCGCCTCGAGATGACC
TTCACGCCGGGCGTCTACTCCGGAAACGCCGACTTCGGCCACACCCTCTTCAACCCGGGCAACGAGCCGAGCTTC
ACGACGCCGTACCTCTACAACTACGTCAACCGGCAGGACCTGGCCGTCAAGCGTAGCCGCGCCGTCGCCAAGTCG
TACTACAGGCCCACGCCCGACGGCCTGCCCGGTAACAGCGACGCCGGCGCCATGGAGTCGTGGCTCCTCTGGAAC
ATGATCGGCCTCTACCCCATGACCGGCCAGCCCGTCTTCCTCATCGGCTCGCCCTGGCTCTCTAACCTGACCATC
GACCTCGGCCGCGGCAAGCAGCTCCGCGTCGAGTCTTCCGGCGGCGGCGGCGACGACGACGCCTTCTACGTCCAG
TCGCTCCGGGTCAACGGCCAGCCCTGGAACCGGAGCTGGCTGACGTGGCACGACGTCTTCGCCGACGGCGGCACG
CTGCAGTTCGTCTTGGGCAGCAACCCGGCCAACTGGACGACGGGGCCGCCCCCGCCCAGTCTGGCCAGCCTGGGC
CCTTACGAGGCCAAGGATCTGCTCCAAAACCTGGTGAGGCCCCAGCCAGGCACGCAAATAGTCCTGTGA
Transcript >Hirsu2|3089
ATGGTACGGTGTGGTGTTCTTGCGTTGCCTCTGGCAGCGGCCGTCGCGTCAGTCGCGAATGCGCTTGACCTGTCC
AAGTATGCCTTGACCGACACCGGCTCTATCAACGGAGGCAACACCTTTCCCGGCGTGTCTCGGCCGCTGGGCATG
GTCAAGCTCGGACCGGATCTAGACACCGGAAGGGACTCTTACTCGGGTTATCAGCCCGCCGGCACCTTCACCGGC
TTCTCCATGCTCCACGAGAGCGGCACTGGCGGAGCTCCCAAGTACGGCGTGGTGTCACAGATGCCGGTGGTGGGA
GTCGTCATGAACCCCCTGAGCGATGTCACCAGTGTCGACCGCGCCGAGCCCGACTTCACAGAGGTCGGCTACTAC
CGGGCGAAGCCGGCCTCAGGTGTGACGGTGGAGCTGGCTGCCGCCTCGAGGGCTGGCATGTATAATTATACCTTT
CCCTGGGGCAGGCAGGGCTCCCACGTCCTCGTCGACGTTTCCCACGTCCTGTCGTCCTACCGCGGTCAGGGCCTG
GAACAACACTACCTCGGAGGCAACATCACCGTACGAGGGGACGGGAACGGCTCCAGCGGCCTGTACTACACCGGC
TTCGGCCGCTACGACAACGGATGGAATCGAGCTGGCCCGTGGACCGTCTATTTCTGCGGACATTTTGACGTCCCG
GCCACGTACCGCACGTTTCTCGGTGCCGACAACTCTAGTGACAAGCTGGCCGAGTTTTCGACCAAACCGAGTTAT
GAGTCCGACTCTGCCCGGCTCGGGGCGCTCTTCACCTTCAACCAGACCCAGGTCGTCTCCCGGGTCGGTGTCTCG
TTCGTGTCCGTGGACCAGGCCTGTTCCAACGTCGAGCGTGAGATCCCACGAGACACGCAGTTGAGTACAGTCCGG
CAGCAAACCCGCGACGCCTGGGACTCGACCGTGTTCTCCAAAGTGACGACGACGGAAACCAACACAACCAAGCTC
AACCAACTCTACTCTGCCCTGTACTTCATGCACCTCATTCCGACAAACAAGACGGGCGAAAATCCTCTGTGGGAG
TCCGAGGAGCCGTATTACGATGACATTTTCACCTTCTGGGACACGTATCGCTGTACGACAGCTCTGTTTCACGTG
CTACAGCCGGAATCGTATGAAGAACTCTTGAGGTCTATGATCGACATCTTCCGTCACCAAGGCTGGATCTCGGAC
GGCCGCTCGTCCTTTTACAACGGCGCTGTTCAGGGCGGCTCCAACGGCGACAACGTCCTTGCCGATGCCTTCGTC
AAGGGAGTCAGGGGCAAGGTCAACTGGGACGACGCGTTCGCGGCCATGGTCAAGAACGCACTGGTCGTGCCGCCC
AACAACAACGACCCGCGCGACCCTACTGGCTCGACCAAGGAGGGCCGAGGCGCGCTGCCCGACTGGCTGAAGTAC
GGCTACATCACACCCAGGTTCTCCCGCTCCGTCAGCCGAGCCGTCGAGTACTCCGTCAACGACTTCTCCCTGGCC
GTCGTCGCCGCCGGTCAAGGCCGATGGTCCGACTACCTCACGTACTCGCGGCGGTCGCTCAACTGGCGCAACCAC
TGGAACGCCAACATGACGGCCCTGGGCTTCTCCGGCTTCGTCGGCCCTCGGGATAGCACCGGGTTCCTCCCGCAG
GACCCCCTGTCCTGCGGCGGCTGCTACTGGGGCGACTACTACTACCAGGGCCTGCCGTGGGAGTACTCCTTCAAT
GCGCACCACGACCTGGCGCACCTCGTCAGGCTGTGCGGCGGGCCCGACGCCTTCGTCCGCCGCCTCGAGATGACC
TTCACGCCGGGCGTCTACTCCGGAAACGCCGACTTCGGCCACACCCTCTTCAACCCGGGCAACGAGCCGAGCTTC
ACGACGCCGTACCTCTACAACTACGTCAACCGGCAGGACCTGGCCGTCAAGCGTAGCCGCGCCGTCGCCAAGTCG
TACTACAGGCCCACGCCCGACGGCCTGCCCGGTAACAGCGACGCCGGCGCCATGGAGTCGTGGCTCCTCTGGAAC
ATGATCGGCCTCTACCCCATGACCGGCCAGCCCGTCTTCCTCATCGGCTCGCCCTGGCTCTCTAACCTGACCATC
GACCTCGGCCGCGGCAAGCAGCTCCGCGTCGAGTCTTCCGGCGGCGGCGGCGACGACGACGCCTTCTACGTCCAG
TCGCTCCGGGTCAACGGCCAGCCCTGGAACCGGAGCTGGCTGACGTGGCACGACGTCTTCGCCGACGGCGGCACG
CTGCAGTTCGTCTTGGGCAGCAACCCGGCCAACTGGACGACGGGGCCGCCCCCGCCCAGTCTGGCCAGCCTGGGC
CCTTACGAGGCCAAGGATCTGCTCCAAAACCTGGTGAGGCCCCAGCCAGGCACGCAAATAGTCCTGTGA
Gene >Hirsu2|3089
ATGGTACGGTGTGGTGTTCTTGCGTTGCCTCTGGCAGCGGCCGTCGCGTCAGTCGCGAATGCGCTTGACCTGTCC
AAGTATGCCTTGACCGACGTAAGTGAGCATAGCGCACCAACCACAGGACACAACCGGACATCCTAACAACCTTCT
CCATGCAGACCGGCTCTATCAACGGAGGCAACACCTTTCCCGGCGTGTCTCGGCCGCTGGGCATGGTCAAGCTCG
GACCGGATCTAGACACCGGAAGGGACTCTTACTCGGGTTATCAGCCCGCCGGCACCTTCACCGGCTTCTCCATGC
TCCACGAGAGCGGCACTGGCGGAGCTCCCAAGTACGGCGTGGTGTCACAGATGCCGGTGGTGGGAGTCGTCATGA
ACCCCCTGAGCGATGTCACCAGTGTCGACCGCGCCGAGCCCGACTTCACAGAGGTCGGCTACTACCGGGCGAAGC
CGGCCTCAGGTGTGACGGTGGAGCTGGCTGCCGCCTCGAGGGCTGGCATGTATAATTATACCTTTCCCTGGGGCA
GGCAGGGCTCCCACGTCCTCGTCGACGTTTCCCACGTCCTGTCGTCCTACCGCGGTCAGGGCCTGGAACAACACT
ACCTCGGAGGCAACATCACCGTACGAGGGGACGGGAACGGCTCCAGCGGCCTGTACTACACCGGCTTCGGCCGCT
ACGACAACGTAAGTGGGAATATGCCTGCCCGGGCATCCTTCTTGTTGACTCACGCGCCCGTCTGTCTAGGGATGG
AATCGAGCTGGCCCGTGGACCGTCTATTTCTGCGGACATTTTGACGTCCCGGCCACGTACCGCACGTTTCTCGGT
GCCGACAACTCTAGTGACAAGCTGGCCGAGTTTTCGACCAAACCGAGTTATGAGTCCGACTCTGCCCGGCTCGGG
GCGCTCTTCACCTTCAACCAGACCCAGGTCGTCTCCCGGGTCGGTGTCTCGTTCGTGTCCGTGGACCAGGCCTGT
TCCAACGTCGAGCGTGAGATCCCACGAGACACGCAGTTGAGTACAGTCCGGCAGCAAACCCGCGACGCCTGGGAC
TCGACCGTGTTCTCCAAAGTGACGACGACGGAAACCAACACAACCAAGCTCAACCAACTCTACTCTGCCCTGTAC
TTCATGCACCTCATTCCGACAAACAAGACGGGCGAAAATCCTCTGTGGGAGTCCGAGGAGCCGTATTACGATGAC
ATTTTCACCTTCTGGGACACGGTGAGCTTCAACTGGATCCCCCCTTCCCCTCCTTTCCGTGCACTACCGCAGCCA
TCCACTTAACAGGACATGGCTAATTTGGACTCCCTGTTATCAGTATCGCTGTACGACAGCTCTGTTTCACGTGCT
ACAGCCGGAATCGTATGAAGAACTCTTGAGGTCTATGATCGACATCTTCCGTCACCAAGGCTGGATCTCGGACGG
CCGCTCGTCCTTTTACAACGGCGCTGTTCAGGGCGGCTCCAACGGCGACAACGTCCTTGCCGATGCCTTCGTCAA
GGGAGTCAGGGGCAAGGTCAACTGGGACGACGCGTTCGCGGCCATGGTCAAGAACGCACTGGTCGTGCCGCCCAA
CAACAACGACCCGCGCGACCCTACTGGCTCGACCAAGGAGGGCCGAGGCGCGCTGCCCGACTGGCTGAAGTACGG
CTACATCACACCCAGGTTCTCCCGCTCCGTCAGCCGAGCCGTCGAGTAGTGAGTCTCTCCCAGTATCCGGGGCGA
GAGGCGAACGCGTGCTGACTCTCCGGCCCCCTCTCAGCTCCGTCAACGACTTCTCCCTGGCCGTCGTCGCCGCCG
GTCAAGGCCGATGGTCCGACTACCTCACGTACTCGCGGCGGTCGCTCAACTGGCGCAACCACTGGAACGCCAACA
TGACGGCCCTGGGCTTCTCCGGCTTCGTCGGCCCTCGGGATAGCACCGGGTTCCTCCCGCAGGACCCCCTGTCCT
GCGGCGGCTGCTACTGGGGCGACTACTACTACCAGGGCCTGCCGTGGGAGTACTCCTTCAATGCGCACCACGACC
TGGCGCACCTCGTCAGGCTGTGCGGCGGGCCCGACGCCTTCGTCCGCCGCCTCGAGATGACCTTCACGCCGGGCG
TCTACTCCGGAAACGCCGACTTCGGCCACACCCTCTTCAACCCGGGCAACGAGCCGAGCTTCACGACGCCGTACC
TCTACAACTACGTCAACCGGCAGGACCTGGCCGTCAAGCGTAGCCGCGCCGTCGCCAAGTCGTACTACAGGCCCA
CGCCCGACGGCCTGCCCGGTAACAGCGACGCCGGCGCCATGGAGTCGTGGCTCCTCTGGAACATGATCGGCCTCT
ACCCCATGACCGGCCAGCCCGTCTTCCTCATCGGCTCGCCCTGGCTCTCTAACCTGACCATCGACCTCGGCCGCG
GCAAGCAGCTCCGCGTCGAGTCTTCCGGCGGCGGCGGCGACGACGACGCCTTCTACGTCCAGTCGCTCCGGGTCA
ACGGCCAGCCCTGGAACCGGAGCTGGCTGACGTGGCACGACGTCTTCGCCGACGGCGGCACGCTGCAGTTCGTCT
TGGGCAGCAACCCGGCCAACTGGACGACGGGGCCGCCCCCGCCCAGTCTGGCCAGCCTGGGCCCTTACGAGGCCA
AGGATCTGCTCCAAAACCTGGTGAGGCCCCAGCCAGGCACGCAAATAGTCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail