Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3074
Gene name
LocationContig_1784:1665..4230
Strand+
Gene length (bp)2565
Transcript length (bp)2334
Coding sequence length (bp)2334
Protein length (aa) 778

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05089 NAGLU Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain 6.9E-124 136 473
PF12972 NAGLU_C Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain 4.2E-61 482 755
PF12971 NAGLU_N Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain 1.0E-14 32 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P54802|ANAG_HUMAN Alpha-N-acetylglucosaminidase OS=Homo sapiens GN=NAGLU PE=1 SV=2 65 726 2.0E-115

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3074
MACSPTRQLLLLLGAALLLSSLVLAEAQSTDGIKGLADRLLKGHGDDFEFVLTTHHERWSRWNPPSNDNYTVRAS
PGGKIRIEGTTLSALARGLRHYATEALHLDNFWFVDSYQKLPSPLPAPAKALTGASVVPWRYNLNTVTFSYTFVW
YSWDDWERMLDWAAWRGVNLQLAWVGYEKVFLDSFRDLGMTDDEILPFLSGPAFQAWNRFGNIKGSWGGLGGLPL
AWIEAQAELQRRIVRRMVELGITPVLPAFPGFVPDAIRRVRPGALVTRAPIWAGVPDWSGDYFLSPLDPAYDELQ
RAFVTKQLEAFGNVTNFYTLDQFNEMAPASGEAAYLSDVSRQTYRGLTAVNPAAVWLMQGWLFVAARDFWSRGRI
DAYLGGVEDRQGLVLLDLYAEAEPQWQRTDSFAGRPWIWCQLHDFGGNMNLFGNVSAATDGPVRALAGSGSLVGL
GLTPEAYEGNEVVYDILLDQAWSPTPIDTTAYFGDWASRRYGGVSPMPPPLLRAWQLLREHVYDNRDPAVPSAGV
GVYQLAPRLSGLVNRTGHFPAPTALHYDGAVLRRVWALMRDAAEREPALWRVPAFRLDLVDVGRQVMGNAFVDVY
LDVVRAYHDAMTAGKQAHGRHGASPEVSAKGRALLDFLDGLDLLLSTNEHFTLHRWLRDAQRWADKAPGSRDLFA
FNARSQVTVWLWESPVLNDYSARAWAGLTRSYYRRRWSIFVEGLERATETGSLDEAALNARIRAFEKRWQYEGFA
LEPGPTASLEDAIKRVQRRWPQVFSTD*
Coding >Hirsu2|3074
ATGGCCTGCTCGCCAACTCGTCAGCTGCTTCTGCTCCTCGGGGCCGCCCTGCTGTTGTCCTCGCTCGTCTTGGCT
GAGGCGCAGTCCACGGATGGCATCAAGGGCTTGGCCGATCGGCTCCTCAAGGGCCACGGCGACGACTTCGAGTTC
GTGCTGACGACGCATCACGAGCGCTGGTCGCGCTGGAATCCGCCGTCGAACGACAACTACACCGTCAGGGCGTCG
CCCGGCGGCAAGATCCGCATCGAGGGCACGACGCTGAGCGCATTGGCCAGGGGTCTCCGTCATTACGCCACCGAG
GCTCTGCACCTCGACAACTTTTGGTTCGTCGACAGCTACCAGAAGCTGCCGAGCCCCTTACCGGCCCCGGCCAAG
GCGCTGACGGGGGCGAGCGTCGTGCCATGGCGGTACAACCTCAATACGGTGACCTTCTCGTACACCTTCGTGTGG
TACAGCTGGGATGACTGGGAGAGAATGCTCGACTGGGCCGCCTGGAGAGGCGTCAACCTGCAGCTGGCCTGGGTC
GGTTACGAGAAGGTGTTCCTCGACAGCTTCCGCGACCTCGGCATGACCGACGACGAAATCTTGCCCTTCCTCAGC
GGCCCGGCCTTCCAGGCCTGGAACCGGTTCGGCAACATCAAGGGCTCCTGGGGCGGGCTGGGCGGCCTGCCGCTG
GCCTGGATCGAGGCCCAGGCCGAGCTGCAGCGGCGGATCGTGCGGCGGATGGTCGAGCTCGGCATCACGCCGGTG
CTGCCGGCCTTCCCGGGCTTCGTCCCGGACGCCATCCGCCGCGTGCGGCCTGGCGCCCTGGTGACGAGGGCGCCC
ATCTGGGCCGGCGTGCCCGACTGGAGCGGCGACTACTTCCTCAGCCCGCTGGACCCGGCCTACGACGAGCTGCAG
CGGGCCTTCGTGACGAAGCAGCTCGAGGCCTTCGGCAACGTCACCAACTTCTACACGCTCGACCAGTTCAACGAG
ATGGCGCCGGCCTCGGGCGAGGCCGCCTACCTGTCGGACGTCTCGCGCCAGACGTACCGCGGCCTGACGGCGGTC
AACCCGGCGGCAGTGTGGCTGATGCAGGGCTGGCTCTTCGTCGCGGCCCGCGATTTCTGGAGCCGCGGCCGGATC
GACGCCTACCTGGGCGGCGTCGAGGACCGGCAGGGCCTCGTCCTCCTCGACCTGTACGCCGAGGCCGAGCCGCAG
TGGCAGCGCACGGACAGCTTCGCGGGCCGGCCGTGGATCTGGTGCCAGCTGCACGACTTCGGCGGCAACATGAAC
CTCTTCGGCAACGTTTCCGCCGCGACGGACGGCCCCGTCCGCGCGCTGGCCGGGTCCGGCTCACTCGTCGGCCTG
GGCCTCACGCCCGAGGCATACGAGGGCAACGAGGTCGTGTACGACATCCTGCTCGACCAGGCCTGGTCTCCGACG
CCCATCGACACGACGGCCTACTTCGGCGACTGGGCGAGCAGGCGATACGGCGGCGTCTCGCCGATGCCGCCGCCG
CTGCTCCGGGCCTGGCAACTGCTCCGCGAGCACGTCTACGACAACCGGGACCCGGCCGTTCCGAGCGCCGGCGTC
GGCGTCTACCAGCTCGCGCCGCGTCTGTCCGGACTCGTCAACCGCACCGGCCACTTCCCGGCGCCGACGGCCCTG
CACTACGACGGCGCCGTCCTGAGGCGCGTCTGGGCCCTGATGCGCGACGCGGCCGAGCGCGAGCCCGCGCTGTGG
CGGGTGCCGGCCTTCCGGCTCGACCTGGTCGACGTGGGCCGGCAGGTCATGGGCAACGCCTTCGTCGACGTCTAC
CTAGACGTCGTCCGCGCGTACCACGACGCCATGACGGCAGGGAAGCAGGCGCACGGGCGGCACGGCGCCAGCCCC
GAGGTGTCGGCCAAGGGCCGGGCGCTGCTCGACTTCCTCGACGGCCTGGACCTGCTGCTGTCGACCAACGAGCAC
TTCACGCTCCACCGCTGGCTCCGGGACGCGCAGCGCTGGGCCGACAAGGCGCCGGGCTCGCGCGACCTGTTCGCC
TTCAACGCCCGCAGCCAGGTGACGGTCTGGCTGTGGGAGTCGCCCGTGCTCAACGACTACTCGGCACGGGCCTGG
GCCGGCCTGACGCGGTCCTACTACCGGCGGCGGTGGTCCATCTTCGTCGAGGGCCTTGAGCGGGCGACGGAGACC
GGGTCGCTGGACGAGGCCGCGCTCAACGCCCGCATCCGGGCCTTCGAGAAGAGGTGGCAGTACGAGGGCTTCGCG
CTCGAGCCCGGGCCGACGGCCAGCCTCGAGGACGCGATCAAGCGTGTCCAGAGGCGGTGGCCGCAAGTCTTTTCG
ACCGATTGA
Transcript >Hirsu2|3074
ATGGCCTGCTCGCCAACTCGTCAGCTGCTTCTGCTCCTCGGGGCCGCCCTGCTGTTGTCCTCGCTCGTCTTGGCT
GAGGCGCAGTCCACGGATGGCATCAAGGGCTTGGCCGATCGGCTCCTCAAGGGCCACGGCGACGACTTCGAGTTC
GTGCTGACGACGCATCACGAGCGCTGGTCGCGCTGGAATCCGCCGTCGAACGACAACTACACCGTCAGGGCGTCG
CCCGGCGGCAAGATCCGCATCGAGGGCACGACGCTGAGCGCATTGGCCAGGGGTCTCCGTCATTACGCCACCGAG
GCTCTGCACCTCGACAACTTTTGGTTCGTCGACAGCTACCAGAAGCTGCCGAGCCCCTTACCGGCCCCGGCCAAG
GCGCTGACGGGGGCGAGCGTCGTGCCATGGCGGTACAACCTCAATACGGTGACCTTCTCGTACACCTTCGTGTGG
TACAGCTGGGATGACTGGGAGAGAATGCTCGACTGGGCCGCCTGGAGAGGCGTCAACCTGCAGCTGGCCTGGGTC
GGTTACGAGAAGGTGTTCCTCGACAGCTTCCGCGACCTCGGCATGACCGACGACGAAATCTTGCCCTTCCTCAGC
GGCCCGGCCTTCCAGGCCTGGAACCGGTTCGGCAACATCAAGGGCTCCTGGGGCGGGCTGGGCGGCCTGCCGCTG
GCCTGGATCGAGGCCCAGGCCGAGCTGCAGCGGCGGATCGTGCGGCGGATGGTCGAGCTCGGCATCACGCCGGTG
CTGCCGGCCTTCCCGGGCTTCGTCCCGGACGCCATCCGCCGCGTGCGGCCTGGCGCCCTGGTGACGAGGGCGCCC
ATCTGGGCCGGCGTGCCCGACTGGAGCGGCGACTACTTCCTCAGCCCGCTGGACCCGGCCTACGACGAGCTGCAG
CGGGCCTTCGTGACGAAGCAGCTCGAGGCCTTCGGCAACGTCACCAACTTCTACACGCTCGACCAGTTCAACGAG
ATGGCGCCGGCCTCGGGCGAGGCCGCCTACCTGTCGGACGTCTCGCGCCAGACGTACCGCGGCCTGACGGCGGTC
AACCCGGCGGCAGTGTGGCTGATGCAGGGCTGGCTCTTCGTCGCGGCCCGCGATTTCTGGAGCCGCGGCCGGATC
GACGCCTACCTGGGCGGCGTCGAGGACCGGCAGGGCCTCGTCCTCCTCGACCTGTACGCCGAGGCCGAGCCGCAG
TGGCAGCGCACGGACAGCTTCGCGGGCCGGCCGTGGATCTGGTGCCAGCTGCACGACTTCGGCGGCAACATGAAC
CTCTTCGGCAACGTTTCCGCCGCGACGGACGGCCCCGTCCGCGCGCTGGCCGGGTCCGGCTCACTCGTCGGCCTG
GGCCTCACGCCCGAGGCATACGAGGGCAACGAGGTCGTGTACGACATCCTGCTCGACCAGGCCTGGTCTCCGACG
CCCATCGACACGACGGCCTACTTCGGCGACTGGGCGAGCAGGCGATACGGCGGCGTCTCGCCGATGCCGCCGCCG
CTGCTCCGGGCCTGGCAACTGCTCCGCGAGCACGTCTACGACAACCGGGACCCGGCCGTTCCGAGCGCCGGCGTC
GGCGTCTACCAGCTCGCGCCGCGTCTGTCCGGACTCGTCAACCGCACCGGCCACTTCCCGGCGCCGACGGCCCTG
CACTACGACGGCGCCGTCCTGAGGCGCGTCTGGGCCCTGATGCGCGACGCGGCCGAGCGCGAGCCCGCGCTGTGG
CGGGTGCCGGCCTTCCGGCTCGACCTGGTCGACGTGGGCCGGCAGGTCATGGGCAACGCCTTCGTCGACGTCTAC
CTAGACGTCGTCCGCGCGTACCACGACGCCATGACGGCAGGGAAGCAGGCGCACGGGCGGCACGGCGCCAGCCCC
GAGGTGTCGGCCAAGGGCCGGGCGCTGCTCGACTTCCTCGACGGCCTGGACCTGCTGCTGTCGACCAACGAGCAC
TTCACGCTCCACCGCTGGCTCCGGGACGCGCAGCGCTGGGCCGACAAGGCGCCGGGCTCGCGCGACCTGTTCGCC
TTCAACGCCCGCAGCCAGGTGACGGTCTGGCTGTGGGAGTCGCCCGTGCTCAACGACTACTCGGCACGGGCCTGG
GCCGGCCTGACGCGGTCCTACTACCGGCGGCGGTGGTCCATCTTCGTCGAGGGCCTTGAGCGGGCGACGGAGACC
GGGTCGCTGGACGAGGCCGCGCTCAACGCCCGCATCCGGGCCTTCGAGAAGAGGTGGCAGTACGAGGGCTTCGCG
CTCGAGCCCGGGCCGACGGCCAGCCTCGAGGACGCGATCAAGCGTGTCCAGAGGCGGTGGCCGCAAGTCTTTTCG
ACCGATTGA
Gene >Hirsu2|3074
ATGGCCTGCTCGCCAACTCGTCAGCTGCTTCTGCTCCTCGGGGCCGCCCTGCTGTTGTCCTCGCTCGTCTTGGCT
GAGGCGCAGTCCACGGATGGCATCAAGGGCTTGGCCGATCGGCTCCTCAAGGGCCACGGCGACGACTTCGAGTTC
GTGCTGACGACGCATCACGAGCGCTGGTCGCGCTGGAATCCGCCGTCGAACGACAACTACACCGTCAGGGCGTCG
CCCGGCGGCAAGATCCGCATCGAGGGCACGACGCTGAGCGCATTGGCCAGGGGGTAAGCAGTTCCTCGTTTCGCG
CTCCTCGAAGGCGCGAGAGTGAGCAGGCGTCCATGCGACGTGCGCTGGGCTGCGCACGATACCGCCCGGTCGGCA
AGGGGCATCATCGCTCGTCTGCGTAAAGAAAAAGGCTTACCGTGACAACCAGTCTCCGTCATTACGCCACCGAGG
CTCTGCACCTCGACAACTTTTGGTTCGTCGACAGCTACCAGAAGCTGCCGAGCCCCTTACCGGCCCCGGCCAAGG
CGCTGACGGGGGCGAGCGTCGTGCCATGGCGGTACAACCTCAATACGGGTGAGTGTCTCCCCCGTCCCCAGCGGC
CAAAATCGAGGCTCGACGGGTGAGAAGACGTTCTGATGACCAAGACGGCTGCCAGTGACCTTCTCGTACACCTTC
GTGTGGTACAGCTGGGATGACTGGGAGAGAATGCTCGACTGGGCCGCCTGGAGAGGCGTCAACCTGCAGCTGGCC
TGGGTCGGTTACGAGAAGGTGTTCCTCGACAGCTTCCGCGACCTCGGCATGACCGACGACGAAATCTTGCCCTTC
CTCAGCGGCCCGGCCTTCCAGGCCTGGAACCGGTTCGGCAACATCAAGGGCTCCTGGGGCGGGCTGGGCGGCCTG
CCGCTGGCCTGGATCGAGGCCCAGGCCGAGCTGCAGCGGCGGATCGTGCGGCGGATGGTCGAGCTCGGCATCACG
CCGGTGCTGCCGGCCTTCCCGGGCTTCGTCCCGGACGCCATCCGCCGCGTGCGGCCTGGCGCCCTGGTGACGAGG
GCGCCCATCTGGGCCGGCGTGCCCGACTGGAGCGGCGACTACTTCCTCAGCCCGCTGGACCCGGCCTACGACGAG
CTGCAGCGGGCCTTCGTGACGAAGCAGCTCGAGGCCTTCGGCAACGTCACCAACTTCTACACGCTCGACCAGTTC
AACGAGATGGCGCCGGCCTCGGGCGAGGCCGCCTACCTGTCGGACGTCTCGCGCCAGACGTACCGCGGCCTGACG
GCGGTCAACCCGGCGGCAGTGTGGCTGATGCAGGGCTGGCTCTTCGTCGCGGCCCGCGATTTCTGGAGCCGCGGC
CGGATCGACGCCTACCTGGGCGGCGTCGAGGACCGGCAGGGCCTCGTCCTCCTCGACCTGTACGCCGAGGCCGAG
CCGCAGTGGCAGCGCACGGACAGCTTCGCGGGCCGGCCGTGGATCTGGTGCCAGCTGCACGACTTCGGCGGCAAC
ATGAACCTCTTCGGCAACGTTTCCGCCGCGACGGACGGCCCCGTCCGCGCGCTGGCCGGGTCCGGCTCACTCGTC
GGCCTGGGCCTCACGCCCGAGGCATACGAGGGCAACGAGGTCGTGTACGACATCCTGCTCGACCAGGCCTGGTCT
CCGACGCCCATCGACACGACGGCCTACTTCGGCGACTGGGCGAGCAGGCGATACGGCGGCGTCTCGCCGATGCCG
CCGCCGCTGCTCCGGGCCTGGCAACTGCTCCGCGAGCACGTCTACGACAACCGGGACCCGGCCGTTCCGAGCGCC
GGCGTCGGCGTCTACCAGCTCGCGCCGCGTCTGTCCGGACTCGTCAACCGCACCGGCCACTTCCCGGCGCCGACG
GCCCTGCACTACGACGGCGCCGTCCTGAGGCGCGTCTGGGCCCTGATGCGCGACGCGGCCGAGCGCGAGCCCGCG
CTGTGGCGGGTGCCGGCCTTCCGGCTCGACCTGGTCGACGTGGGCCGGCAGGTCATGGGCAACGCCTTCGTCGAC
GTCTACCTAGACGTCGTCCGCGCGTACCACGACGCCATGACGGCAGGGAAGCAGGCGCACGGGCGGCACGGCGCC
AGCCCCGAGGTGTCGGCCAAGGGCCGGGCGCTGCTCGACTTCCTCGACGGCCTGGACCTGCTGCTGTCGACCAAC
GAGCACTTCACGCTCCACCGCTGGCTCCGGGACGCGCAGCGCTGGGCCGACAAGGCGCCGGGCTCGCGCGACCTG
TTCGCCTTCAACGCCCGCAGCCAGGTGACGGTCTGGCTGTGGGAGTCGCCCGTGCTCAACGACTACTCGGCACGG
GCCTGGGCCGGCCTGACGCGGTCCTACTACCGGCGGCGGTGGTCCATCTTCGTCGAGGGCCTTGAGCGGGCGACG
GAGACCGGGTCGCTGGACGAGGCCGCGCTCAACGCCCGCATCCGGGCCTTCGAGAAGAGGTGGCAGTACGAGGGC
TTCGCGCTCGAGCCCGGGCCGACGGCCAGCCTCGAGGACGCGATCAAGCGTGTCCAGAGGCGGTGGCCGCAAGTC
TTTTCGACCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail