Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3069
Gene name
LocationContig_1782:3111..4652
Strand-
Gene length (bp)1541
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 2.8E-23 169 347
PF01569 PAP2 PAP2 superfamily 2.1E-08 238 349

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10142|AUR1_SCHPO Inositol phosphorylceramide synthase catalytic subunit aur1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aur1 PE=1 SV=1 24 376 6.0E-103
sp|O13332|AUR1_CANAL Inositol phosphorylceramide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AUR1 PE=1 SV=2 54 371 6.0E-95
sp|P36107|AUR1_YEAST Inositol phosphorylceramide synthase catalytic subunit AUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUR1 PE=1 SV=1 44 371 2.0E-87
sp|P38954|IPT1_YEAST Inositolphosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPT1 PE=1 SV=2 182 302 9.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 82 104 22
3 124 146 22
4 153 175 22
5 185 207 22
6 214 233 19
7 266 288 22
8 300 322 22
9 332 354 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3069
MADLPGSLPGKPVLPSLWTDSIALAVLNRLPARYHAARRRSRSNARPMRGHGSADITSLQRSFSLWDGVRDLARR
RWHPADLQYLFLAGLALFSLSIAPSAPVVKTLALVGAACILLMPATRQFFLPSVTIWVWLVYFFCSRFIPYEYRP
HIWVRVLPALENVLYGANLSNILSAHQHAVLDILAWLPYGIIHFGAPAVCSLLMFVFGAPGTTAVFARTFGWMSI
VGVTIQLVFPCTPPWYENEHGLVPATYGMSGSPAGLARIDAIFGIDLYTTNFTAAPLPFGAFPSLHGGYAVLEAL
FMSHCFPQFKVFFIGYAGWIWWSTMYLSHHYAIDLVGGGLIAMAFFYSARARWLPRRQPDKMTRWDYDYVEIGHR
LRPADEEFGAGPGLGHYTALGLFSHRRAGSSDGWTIGSSSSYSSSSGTVSPTSSDSSPGVLVMDMESNGQLWDGH
GSPRDVELSEVVILR*
Coding >Hirsu2|3069
ATGGCAGACCTCCCGGGCTCGCTCCCGGGGAAGCCGGTGCTTCCGTCGCTGTGGACGGACAGCATCGCGCTCGCC
GTCCTCAACCGCCTGCCCGCCCGCTACCACGCCGCCCGCCGCCGTAGCCGCTCCAACGCCCGGCCGATGCGCGGC
CACGGCAGCGCCGACATCACCAGCCTGCAGCGCTCCTTTAGCCTCTGGGACGGCGTGCGCGACCTGGCCCGCCGC
CGCTGGCATCCCGCCGACCTGCAGTACCTCTTCCTCGCCGGCCTGGCCCTGTTCTCGCTGTCGATTGCGCCCTCG
GCCCCGGTCGTCAAGACGCTGGCCCTGGTCGGCGCCGCCTGCATCCTGCTCATGCCCGCCACCCGCCAATTCTTC
TTGCCCTCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGCAGCCGCTTCATCCCCTACGAATACCGCCCG
CACATCTGGGTCCGGGTGCTGCCGGCGCTGGAGAACGTGCTGTACGGCGCCAACCTGTCCAACATCCTGTCGGCG
CACCAGCACGCCGTGCTCGACATCCTGGCCTGGCTGCCGTACGGCATCATCCACTTCGGCGCGCCGGCCGTCTGC
TCGCTGCTCATGTTCGTCTTCGGCGCGCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATC
GTCGGCGTCACCATCCAGCTCGTCTTCCCCTGCACGCCGCCGTGGTACGAGAACGAGCACGGCCTGGTGCCGGCG
ACGTACGGCATGTCGGGCTCGCCCGCCGGGCTGGCGCGCATCGACGCCATCTTCGGCATCGACCTCTACACGACC
AATTTCACGGCCGCGCCGCTGCCCTTTGGCGCCTTCCCGTCGCTGCACGGCGGCTACGCCGTGCTCGAGGCCCTC
TTCATGAGCCACTGCTTCCCGCAGTTCAAGGTCTTCTTCATCGGCTACGCCGGCTGGATCTGGTGGTCGACCATG
TACCTGAGCCACCACTACGCCATCGACCTGGTCGGCGGCGGCCTCATCGCCATGGCCTTCTTCTACTCGGCCCGC
GCCCGCTGGCTGCCGCGCCGCCAGCCCGACAAGATGACGCGCTGGGACTACGACTACGTCGAGATCGGCCACCGC
CTGCGCCCCGCCGACGAGGAGTTCGGCGCCGGGCCCGGCCTCGGCCACTACACGGCCCTCGGCCTCTTCAGCCAC
CGCCGCGCCGGCTCCAGCGACGGCTGGACCATCGGCAGCAGCTCCAGCTACAGCTCCAGCAGCGGCACCGTCAGC
CCGACCTCGTCCGACAGCTCGCCCGGCGTGCTGGTCATGGACATGGAGAGCAACGGCCAGCTGTGGGACGGCCAC
GGCTCGCCCCGCGACGTCGAATTGAGCGAGGTCGTCATCCTGCGGTGA
Transcript >Hirsu2|3069
ATGGCAGACCTCCCGGGCTCGCTCCCGGGGAAGCCGGTGCTTCCGTCGCTGTGGACGGACAGCATCGCGCTCGCC
GTCCTCAACCGCCTGCCCGCCCGCTACCACGCCGCCCGCCGCCGTAGCCGCTCCAACGCCCGGCCGATGCGCGGC
CACGGCAGCGCCGACATCACCAGCCTGCAGCGCTCCTTTAGCCTCTGGGACGGCGTGCGCGACCTGGCCCGCCGC
CGCTGGCATCCCGCCGACCTGCAGTACCTCTTCCTCGCCGGCCTGGCCCTGTTCTCGCTGTCGATTGCGCCCTCG
GCCCCGGTCGTCAAGACGCTGGCCCTGGTCGGCGCCGCCTGCATCCTGCTCATGCCCGCCACCCGCCAATTCTTC
TTGCCCTCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGCAGCCGCTTCATCCCCTACGAATACCGCCCG
CACATCTGGGTCCGGGTGCTGCCGGCGCTGGAGAACGTGCTGTACGGCGCCAACCTGTCCAACATCCTGTCGGCG
CACCAGCACGCCGTGCTCGACATCCTGGCCTGGCTGCCGTACGGCATCATCCACTTCGGCGCGCCGGCCGTCTGC
TCGCTGCTCATGTTCGTCTTCGGCGCGCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATC
GTCGGCGTCACCATCCAGCTCGTCTTCCCCTGCACGCCGCCGTGGTACGAGAACGAGCACGGCCTGGTGCCGGCG
ACGTACGGCATGTCGGGCTCGCCCGCCGGGCTGGCGCGCATCGACGCCATCTTCGGCATCGACCTCTACACGACC
AATTTCACGGCCGCGCCGCTGCCCTTTGGCGCCTTCCCGTCGCTGCACGGCGGCTACGCCGTGCTCGAGGCCCTC
TTCATGAGCCACTGCTTCCCGCAGTTCAAGGTCTTCTTCATCGGCTACGCCGGCTGGATCTGGTGGTCGACCATG
TACCTGAGCCACCACTACGCCATCGACCTGGTCGGCGGCGGCCTCATCGCCATGGCCTTCTTCTACTCGGCCCGC
GCCCGCTGGCTGCCGCGCCGCCAGCCCGACAAGATGACGCGCTGGGACTACGACTACGTCGAGATCGGCCACCGC
CTGCGCCCCGCCGACGAGGAGTTCGGCGCCGGGCCCGGCCTCGGCCACTACACGGCCCTCGGCCTCTTCAGCCAC
CGCCGCGCCGGCTCCAGCGACGGCTGGACCATCGGCAGCAGCTCCAGCTACAGCTCCAGCAGCGGCACCGTCAGC
CCGACCTCGTCCGACAGCTCGCCCGGCGTGCTGGTCATGGACATGGAGAGCAACGGCCAGCTGTGGGACGGCCAC
GGCTCGCCCCGCGACGTCGAATTGAGCGAGGTCGTCATCCTGCGGTGA
Gene >Hirsu2|3069
ATGGCAGACCTCCCGGGCTCGCTCCCGGGGAAGCCGGTGCTTCCGTCGCTGTGGACGGACAGCATCGCGCTCGCC
GTCCTCAACCGCCTGCCCGCCCGCTACCACGCCGCCCGCCGCCGTAGCCGCTCCAACGCCCGGCCGATGCGCGGC
CACGGCAGCGCCGACATCACCAGCCTGCAGCGCTCCTTTAGCCTCTGGGACGGCGTGCGCGACCTGGCCCGCCGC
CGCTGGCATCCCGCCGACCTGCAGTACCTCTTCCTCGCCGGCCTGGCCCTGTTCTCGCTGTCGATTGCGCCCTCG
GCCCCGGTCGTCAAGACGCTGGCCCTGGTCGGCGCCGCCTGCATCCTGCTCATGCCCGCCACCCGCCAATTCTTC
TTGCCCTCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGCAGCCGGTGAGTGTGTGGGCCCGGCGGGCGA
ACGATCCGGGGAAGACCCCGGTCTCCCCGCTTCACGAAGCTTTCCCTCCTCTCCCTTCTCTCTCGACCTCTCTCA
CACGTCGTCGCCATGAGCGCTCGCGCTAACCGGTCCGGCGCAGCTTCATCCCCTACGAATACCGCCCGCACATCT
GGGTCCGGGTGCTGCCGGCGCTGGAGAACGTGCTGTACGGCGCCAACCTGTCCAACATCCTGTCGGCGCACCAGC
ACGCCGTGCTCGACATCCTGGCCTGGCTGCCGTACGGCATCATCCACTTCGGCGCGCCGGCCGTCTGCTCGCTGC
TCATGTTCGTCTTCGGCGCGCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCGTCGGCG
TCACCATCCAGCTCGTCTTCCCCTGCACGCCGCCGTGGTACGAGAACGAGCACGGCCTGGTGCCGGCGACGTACG
GCATGTCGGGCTCGCCCGCCGGGCTGGCGCGCATCGACGCCATCTTCGGCATCGACCTCTACACGACCAATTTCA
CGGCCGCGCCGCTGCCCTTTGGCGCCTTCCCGTCGCTGCACGGCGGCTACGCCGTGCTCGAGGCCCTCTTCATGA
GCCACTGCTTCCCGCAGTTCAAGGTCTTCTTCATCGGCTACGCCGGCTGGATCTGGTGGTCGACCATGTACCTGA
GCCACCACTACGCCATCGACCTGGTCGGCGGCGGCCTCATCGCCATGGCCTTCTTCTACTCGGCCCGCGCCCGCT
GGCTGCCGCGCCGCCAGCCCGACAAGATGACGCGCTGGGACTACGACTACGTCGAGATCGGCCACCGCCTGCGCC
CCGCCGACGAGGAGTTCGGCGCCGGGCCCGGCCTCGGCCACTACACGGCCCTCGGCCTCTTCAGCCACCGCCGCG
CCGGCTCCAGCGACGGCTGGACCATCGGCAGCAGCTCCAGCTACAGCTCCAGCAGCGGCACCGTCAGCCCGACCT
CGTCCGACAGCTCGCCCGGCGTGCTGGTCATGGACATGGAGAGCAACGGCCAGCTGTGGGACGGCCACGGCTCGC
CCCGCGACGTCGAATTGAGCGAGGTCGTCATCCTGCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail