Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3065
Gene name
LocationContig_1781:25..1465
Strand-
Gene length (bp)1440
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 8.4E-40 3 185
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 3.0E-09 209 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 48 312 9.0E-12
sp|Q8BU33|ILVBL_MOUSE Acetolactate synthase-like protein OS=Mus musculus GN=Ilvbl PE=1 SV=1 48 384 6.0E-08
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 9 225 2.0E-07
sp|B4S4J4|MEND_PROA2 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=menD PE=3 SV=1 5 271 2.0E-07
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 10 197 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 48 312 9.0E-12
sp|Q8BU33|ILVBL_MOUSE Acetolactate synthase-like protein OS=Mus musculus GN=Ilvbl PE=1 SV=1 48 384 6.0E-08
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 9 225 2.0E-07
sp|B4S4J4|MEND_PROA2 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=menD PE=3 SV=1 5 271 2.0E-07
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 10 197 2.0E-07
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 1 174 6.0E-07
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 14 309 3.0E-06
sp|A1L0T0|ILVBL_HUMAN Acetolactate synthase-like protein OS=Homo sapiens GN=ILVBL PE=1 SV=2 48 384 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3065
MYTASFAFFEAIREAGITHCFVNLGSDHPSMIEAMVKGQREAADRFPRIITCPSEMVAMSMADGFARRSGRPQCV
IVHVDVGTQALGPAVHNASVGRAPILVFAGISPVTLEGEMRGSRSEFIHWMQDIPDQKAILGQYCRYAAEIKTGV
NIKQMVNRALQFATSQPQGPVYLCGAREVMEAEIEPYSLDQALWGPVRLGGLPADAASTVARALARADRPLLVTG
YSGRNHAIPRALTELADAVATLRVLDTGGCDMCLSAEHPAWLGTKYGVDDSIAEADVIVVLDCDVPWIPTRCKPR
PDARVFHIDVDPLKQLMPLFYVQSESRFRADALASVEQILAELRAGDAAETLRARDRAGEEKARRQAHASKLASI
GRAAEPLPDGRFGSGHLSRVLRAALYPRQHPADAAGLLDQLRRRWARLVRRRGAGH*
Coding >Hirsu2|3065
ATGTATACCGCGTCCTTTGCCTTCTTCGAGGCCATCCGGGAGGCCGGTATCACCCACTGCTTCGTCAACCTGGGC
TCCGACCACCCGAGCATGATCGAGGCCATGGTCAAGGGCCAGCGCGAGGCCGCCGACCGGTTTCCTCGCATCATC
ACCTGTCCCAGCGAGATGGTCGCCATGTCCATGGCCGACGGCTTCGCCCGGCGCAGCGGCAGGCCGCAGTGCGTC
ATCGTGCACGTCGACGTCGGCACCCAGGCGCTGGGCCCGGCCGTCCACAACGCGTCGGTCGGGCGCGCGCCCATC
CTCGTCTTCGCCGGCATCTCGCCCGTTACGCTCGAGGGCGAGATGCGCGGCTCCCGCTCCGAGTTCATCCACTGG
ATGCAGGATATCCCGGACCAGAAGGCCATCCTCGGCCAGTACTGCCGCTATGCCGCCGAGATCAAGACGGGCGTC
AATATCAAGCAGATGGTGAACCGCGCGCTCCAGTTCGCGACCAGCCAGCCGCAGGGGCCCGTCTACCTGTGCGGC
GCCCGGGAGGTCATGGAGGCGGAGATCGAGCCCTATTCCCTCGACCAGGCCCTCTGGGGCCCGGTCCGTCTGGGC
GGCCTGCCGGCCGATGCGGCGAGCACTGTGGCCCGAGCCTTGGCGCGGGCCGACCGGCCGCTGCTCGTCACCGGC
TACTCGGGCCGTAATCACGCGATCCCCCGAGCCTTGACCGAGCTGGCCGACGCCGTCGCCACCCTCCGCGTCCTC
GACACGGGGGGCTGCGATATGTGCCTATCCGCCGAGCACCCTGCCTGGCTGGGGACCAAGTACGGCGTCGACGAC
TCCATCGCCGAGGCCGACGTCATCGTGGTTTTGGACTGCGACGTTCCCTGGATCCCGACGCGCTGCAAACCTAGG
CCCGATGCCCGCGTCTTCCATATCGACGTCGACCCCCTAAAGCAGCTGATGCCCCTCTTCTACGTCCAGTCCGAG
TCACGGTTTCGGGCCGATGCGCTCGCCTCCGTGGAGCAGATCCTGGCCGAGCTCCGGGCCGGGGACGCGGCCGAG
ACGCTCCGGGCCCGAGACCGGGCCGGCGAGGAGAAGGCTCGGCGGCAGGCGCACGCGTCCAAGCTCGCGAGCATC
GGCAGGGCGGCCGAGCCGTTGCCCGACGGCCGCTTCGGCTCCGGGCACCTGAGCCGGGTGCTCCGGGCGGCGCTT
TATCCACGACAACATCCAGCCGACGCTGCCGGGCTCCTGGATCAACTGCGGCGGCGGTGGGCTCGGCTGGTCCGG
CGGCGGGGCGCTGGGCATTAA
Transcript >Hirsu2|3065
ATGTATACCGCGTCCTTTGCCTTCTTCGAGGCCATCCGGGAGGCCGGTATCACCCACTGCTTCGTCAACCTGGGC
TCCGACCACCCGAGCATGATCGAGGCCATGGTCAAGGGCCAGCGCGAGGCCGCCGACCGGTTTCCTCGCATCATC
ACCTGTCCCAGCGAGATGGTCGCCATGTCCATGGCCGACGGCTTCGCCCGGCGCAGCGGCAGGCCGCAGTGCGTC
ATCGTGCACGTCGACGTCGGCACCCAGGCGCTGGGCCCGGCCGTCCACAACGCGTCGGTCGGGCGCGCGCCCATC
CTCGTCTTCGCCGGCATCTCGCCCGTTACGCTCGAGGGCGAGATGCGCGGCTCCCGCTCCGAGTTCATCCACTGG
ATGCAGGATATCCCGGACCAGAAGGCCATCCTCGGCCAGTACTGCCGCTATGCCGCCGAGATCAAGACGGGCGTC
AATATCAAGCAGATGGTGAACCGCGCGCTCCAGTTCGCGACCAGCCAGCCGCAGGGGCCCGTCTACCTGTGCGGC
GCCCGGGAGGTCATGGAGGCGGAGATCGAGCCCTATTCCCTCGACCAGGCCCTCTGGGGCCCGGTCCGTCTGGGC
GGCCTGCCGGCCGATGCGGCGAGCACTGTGGCCCGAGCCTTGGCGCGGGCCGACCGGCCGCTGCTCGTCACCGGC
TACTCGGGCCGTAATCACGCGATCCCCCGAGCCTTGACCGAGCTGGCCGACGCCGTCGCCACCCTCCGCGTCCTC
GACACGGGGGGCTGCGATATGTGCCTATCCGCCGAGCACCCTGCCTGGCTGGGGACCAAGTACGGCGTCGACGAC
TCCATCGCCGAGGCCGACGTCATCGTGGTTTTGGACTGCGACGTTCCCTGGATCCCGACGCGCTGCAAACCTAGG
CCCGATGCCCGCGTCTTCCATATCGACGTCGACCCCCTAAAGCAGCTGATGCCCCTCTTCTACGTCCAGTCCGAG
TCACGGTTTCGGGCCGATGCGCTCGCCTCCGTGGAGCAGATCCTGGCCGAGCTCCGGGCCGGGGACGCGGCCGAG
ACGCTCCGGGCCCGAGACCGGGCCGGCGAGGAGAAGGCTCGGCGGCAGGCGCACGCGTCCAAGCTCGCGAGCATC
GGCAGGGCGGCCGAGCCGTTGCCCGACGGCCGCTTCGGCTCCGGGCACCTGAGCCGGGTGCTCCGGGCGGCGCTT
TATCCACGACAACATCCAGCCGACGCTGCCGGGCTCCTGGATCAACTGCGGCGGCGGTGGGCTCGGCTGGTCCGG
CGGCGGGGCGCTGGGCATTAA
Gene >Hirsu2|3065
ATGTATACCGCGTCCTTTGCCTTCTTCGAGGCCATCCGGGAGGCCGGTATCACCCACTGCTTCGTCAACCTGGGC
TCCGACCACCCGAGCATGATCGAGGCCATGGTCAAGGGCCAGCGCGAGGCCGCCGACCGGTTTCCTCGCATCATC
ACCTGTCCCAGCGAGGTTCGTCCCCNNTGTTGTCCCCCCCCCCCCCCCCCTCTCTTCTCCCCCAAGCGCCGAAAG
CGCCGGGCTGACTCGGTCCGGACACCCCGGGCTCCAGATGGTCGCCATGTCCATGGCCGACGGCTTCGCCCGGCG
CAGCGGCAGGCCGCAGTGCGTCATCGTGCACGTCGACGTCGGCACCCAGGCGCTGGGCCCGGCCGTCCACAACGC
GTCGGTCGGGCGCGCGCCCATCCTCGTCTTCGCCGGCATCTCGCCCGTTACGCTCGAGGGCGAGATGCGCGGCTC
CCGCTCCGAGTTCATCCACTGGATGCAGGATATCCCGGACCAGAAGGCCATCCTCGGCCAGTACTGCCGCTATGC
CGCCGAGATCAAGACGGGCGTCAATATCAAGCAGATGGTGAACCGCGCGCTCCAGTTCGCGACCAGCCAGCCGCA
GGGGCCCGTCTACCTGTGCGGCGCCCGGGAGGTCATGGAGGCGGAGATCGAGCCCTATTCCCTCGACCAGGCCCT
CTGGGGCCCGGTCCGTCTGGGCGGCCTGCCGGCCGATGCGGCGAGCACTGTGGCCCGAGCCTTGGCGCGGGCCGA
CCGGCCGCTGCTCGTCACCGGCTACTCGGGCCGTAATCACGCGATCCCCCGAGCCTTGACCGAGCTGGCCGACGC
CGTCGCCACCCTCCGCGTCCTCGACACGGGGGGCTGCGATATGTGCCTATCCGCCGAGCACCCTGCCTGGCTGGG
GACCAAGTACGGCGTCGACGACTCCATCGCCGAGGCCGACGTCATCGTGGTTTTGGACTGCGACGTTCCCTGGAT
CCCGACGCGCTGCAAACCTAGGCCCGATGCCCGCGTCTTCCATATCGACGTCGACCCCCTAAAGCAGCTGATGCC
CCTCTTCTACGTCCAGTCCGAGTCACGGTTTCGGGCCGATGCGCTCGCCTCCGTGGAGCAGATCCTGGCCGAGCT
CCGGGCCGGGGACGCGGCCGAGACGCTCCGGGCCCGAGACCGGGCCGGCGAGGAGAAGGCTCGGCGGCAGGCGCA
CGCGTCCAAGCTCGCGAGCATCGGCAGGGCGGCCGAGCCGTTGCCCGACGGCCGCTTCGGCTCCGGGCACCTGAG
CCGGGTGCTCCGGGCGGCGTGCCCGCAGGACACCATCTGGGCGGTCGAGGCCGTCACGAACACAGGCTTTATCCA
CGACAACATCCAGCCGACGCTGCCGGGCTCCTGGATCAACTGCGGCGGCGGTGGGCTCGGCTGGTCCGGCGGCGG
GGCGCTGGGCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail