Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3062
Gene name
LocationContig_178:25579..26663
Strand-
Gene length (bp)1084
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US27|LOA1_SCHPO Putative lysophosphatidic acid:oleoyl-CoA acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps66 PE=3 SV=2 1 326 2.0E-13
sp|Q06508|LOA1_YEAST Lysophosphatidic acid:oleoyl-CoA acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LOA1 PE=1 SV=1 1 197 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3062
MEKYSQFRDRSTGIAPFLPVSTPLSAVSAVTHSLLFFFRLPFFLTYALAYFIIFHHLPLPVVARKMALWGMMAIP
GIWWVDLQLDGVRRGTLSEQPRERVPHPGSVIAANFTSPIDAVYLAAVFDPVFTISYPGTRKLQRVCLLGAVTMA
LSPVRTAPPPNAKLVDIEDLLEEYPNRVIAVFPECGTTNGKAILPFSPALAQCPAHVHVFPVSIRYAPSDVTTPV
PGQWFKFLWNLLSRPTTCIRVRIAESRRKDAAAASTKSGSRTTNGAGGDPRQRKATDVEDPEQEKQFLDRIAEAL
ARLSRVKRVGLTMNDKAAFIAALNGKKS*
Coding >Hirsu2|3062
ATGGAGAAGTACAGCCAGTTTCGCGACAGATCCACCGGCATTGCGCCCTTCTTGCCCGTGTCGACGCCTCTGTCC
GCCGTGTCGGCGGTGACGCACAGCCTGCTGTTCTTCTTCCGCCTCCCCTTCTTCCTCACCTACGCGCTCGCCTAC
TTCATCATCTTCCACCATCTGCCGCTGCCCGTCGTTGCCCGCAAGATGGCGCTCTGGGGCATGATGGCCATCCCC
GGCATCTGGTGGGTCGACCTCCAGCTTGACGGCGTCCGGCGCGGCACCCTCTCGGAGCAGCCGCGCGAGCGCGTC
CCCCATCCGGGGTCGGTGATCGCTGCCAACTTCACCAGCCCCATCGACGCCGTCTACCTCGCCGCCGTCTTCGAC
CCCGTCTTTACAATCTCGTATCCGGGCACGCGCAAGCTGCAGCGCGTGTGCCTGCTGGGCGCCGTCACCATGGCC
CTCTCTCCGGTCCGGACGGCCCCGCCCCCCAACGCCAAACTGGTAGACATCGAGGATCTGCTCGAGGAGTATCCG
AACCGGGTCATTGCCGTGTTCCCCGAGTGTGGCACCACCAACGGCAAAGCCATCTTGCCCTTCAGTCCGGCCTTG
GCCCAGTGTCCGGCCCACGTGCACGTCTTTCCGGTCAGCATTCGATACGCGCCCTCCGATGTCACGACGCCGGTT
CCCGGCCAGTGGTTCAAGTTCTTGTGGAATCTTCTGTCGCGTCCCACGACTTGCATCCGCGTGCGCATCGCCGAG
AGTCGCCGAAAGGACGCGGCCGCCGCCTCCACCAAAAGCGGTTCCAGGACGACGAACGGTGCCGGCGGGGACCCG
AGACAGCGAAAGGCGACGGATGTCGAGGATCCGGAGCAAGAGAAGCAGTTTCTGGATCGGATTGCCGAAGCTTTG
GCGCGATTGAGTCGCGTCAAGAGGGTTGGCTTGACAATGAACGACAAAGCAGCGTTCATTGCGGCCCTGAATGGC
AAGAAGTCGTGA
Transcript >Hirsu2|3062
ATGGAGAAGTACAGCCAGTTTCGCGACAGATCCACCGGCATTGCGCCCTTCTTGCCCGTGTCGACGCCTCTGTCC
GCCGTGTCGGCGGTGACGCACAGCCTGCTGTTCTTCTTCCGCCTCCCCTTCTTCCTCACCTACGCGCTCGCCTAC
TTCATCATCTTCCACCATCTGCCGCTGCCCGTCGTTGCCCGCAAGATGGCGCTCTGGGGCATGATGGCCATCCCC
GGCATCTGGTGGGTCGACCTCCAGCTTGACGGCGTCCGGCGCGGCACCCTCTCGGAGCAGCCGCGCGAGCGCGTC
CCCCATCCGGGGTCGGTGATCGCTGCCAACTTCACCAGCCCCATCGACGCCGTCTACCTCGCCGCCGTCTTCGAC
CCCGTCTTTACAATCTCGTATCCGGGCACGCGCAAGCTGCAGCGCGTGTGCCTGCTGGGCGCCGTCACCATGGCC
CTCTCTCCGGTCCGGACGGCCCCGCCCCCCAACGCCAAACTGGTAGACATCGAGGATCTGCTCGAGGAGTATCCG
AACCGGGTCATTGCCGTGTTCCCCGAGTGTGGCACCACCAACGGCAAAGCCATCTTGCCCTTCAGTCCGGCCTTG
GCCCAGTGTCCGGCCCACGTGCACGTCTTTCCGGTCAGCATTCGATACGCGCCCTCCGATGTCACGACGCCGGTT
CCCGGCCAGTGGTTCAAGTTCTTGTGGAATCTTCTGTCGCGTCCCACGACTTGCATCCGCGTGCGCATCGCCGAG
AGTCGCCGAAAGGACGCGGCCGCCGCCTCCACCAAAAGCGGTTCCAGGACGACGAACGGTGCCGGCGGGGACCCG
AGACAGCGAAAGGCGACGGATGTCGAGGATCCGGAGCAAGAGAAGCAGTTTCTGGATCGGATTGCCGAAGCTTTG
GCGCGATTGAGTCGCGTCAAGAGGGTTGGCTTGACAATGAACGACAAAGCAGCGTTCATTGCGGCCCTGAATGGC
AAGAAGTCGTGA
Gene >Hirsu2|3062
ATGGAGAAGTACAGCCAGTTTCGCGACAGATGTAAGGGTCGTCACGTTCCGCGAGGCAGAGAAGCCCGTACCAGT
CTGCCACCCCTCGCGAACACCGTCCGCCTGCTTACTTGTGCGCCTACTTCTAGCCACCGGCATTGCGCCCTTCTT
GCCCGTGTCGACGCCTCTGTCCGCCGTGTCGGCGGTGACGCACAGCCTGCTGTTCTTCTTCCGCCTCCCCTTCTT
CCTCACCTACGCGCTCGCCTACTTCATCATCTTCCACCATCTGCCGCTGCCCGTCGTTGCCCGCAAGATGGCGCT
CTGGGGCATGATGGCCATCCCCGGCATCTGGTGGGTCGACCTCCAGCTTGACGGCGTCCGGCGCGGCACCCTCTC
GGAGCAGCCGCGCGAGCGCGTCCCCCATCCGGGGTCGGTGATCGCTGCCAACTTCACCAGCCCCATCGACGCCGT
CTACCTCGCCGCCGTCTTCGACCCCGTCTTTACAATCTCGTATCCGGGCACGCGCAAGCTGCAGCGCGTGTGCCT
GCTGGGCGCCGTCACCATGGCCCTCTCTCCGGTCCGGACGGCCCCGCCCCCCAACGCCAAACTGGTAGACATCGA
GGATCTGCTCGAGGAGTATCCGAACCGGGTCATTGCCGTGTTCCCCGAGTGTGGCACCACCAACGGCAAAGCCAT
CTTGCCCTTCAGTCCGGCCTTGGCCCAGTGTCCGGCCCACGTGCACGTCTTTCCGGTCAGCATTCGATACGCGCC
CTCCGATGTCACGACGCCGGTTCCCGGCCAGTGGTTCAAGTTCTTGTGGAATCTTCTGTCGCGTCCCACGACTTG
CATCCGCGTGCGCATCGCCGAGAGTCGCCGAAAGGACGCGGCCGCCGCCTCCACCAAAAGCGGTTCCAGGACGAC
GAACGGTGCCGGCGGGGACCCGAGACAGCGAAAGGCGACGGATGTCGAGGATCCGGAGCAAGAGAAGCAGTTTCT
GGATCGGATTGCCGAAGCTTTGGCGCGATTGAGTCGCGTCAAGAGGGTTGGCTTGACAATGAACGACAAAGCAGC
GTTCATTGCGGCCCTGAATGGCAAGAAGTCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail