Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3055
Gene name
LocationContig_178:12016..13528
Strand-
Gene length (bp)1512
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-44 28 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 8 448 1.0E-72
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 8 445 2.0E-68
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 11 477 5.0E-61
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 11 482 3.0E-60
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 11 459 8.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 8 448 1.0E-72
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 8 445 2.0E-68
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 11 477 5.0E-61
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 11 482 3.0E-60
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 11 459 8.0E-60
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 7 456 4.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 6 204 1.0E-31
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 3 441 1.0E-30
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 8 472 3.0E-29
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 6 209 8.0E-29
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 19 480 1.0E-28
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 7 465 2.0E-24
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 79 480 3.0E-24
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 3 473 4.0E-24
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 18 199 1.0E-23
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 7 465 2.0E-23
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 36 441 1.0E-21
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 18 474 8.0E-21
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 2 425 2.0E-20
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 18 474 6.0E-17
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 16 441 9.0E-17
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 7 473 1.0E-15
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 46 472 1.0E-14
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 16 430 1.0E-14
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 36 474 2.0E-14
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 3 471 9.0E-14
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 19 456 3.0E-13
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 252 476 1.0E-12
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 21 184 1.0E-12
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 19 180 1.0E-12
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 25 439 3.0E-12
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 37 200 6.0E-12
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 19 331 8.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 19 331 9.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 24 418 1.0E-11
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 36 200 2.0E-11
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 18 232 8.0E-11
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 3 339 2.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 249 474 3.0E-10
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 38 473 3.0E-10
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 3 339 7.0E-10
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 21 480 3.0E-09
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 37 211 8.0E-09
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 55 340 2.0E-07
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 100 236 3.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 23 201 1.0E-06
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 72 326 1.0E-06
sp|O24723|PHDT_NOCSK Probable 1-hydroxy-2-naphthoate transporter OS=Nocardioides sp. (strain KP7) PE=3 SV=1 8 199 1.0E-06
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 34 192 2.0E-06
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 44 199 3.0E-06
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 34 180 8.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 14 179 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 87 109 22
4 113 135 22
5 148 170 22
6 175 197 22
7 255 277 22
8 297 319 22
9 349 368 19
10 373 392 19
11 413 435 22
12 445 467 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3055
MAQPAVPDGQPYSIFDPRQKALIVLVVSVAATFSGFASNIYFPALSAIADDIGTSIELVNLTVTFYLIFQGLAPS
VWGPVSDVKGRRVAYCCTFVVFLGACVGLAEARNYATLLVLRCVQSAGSASTVAIGSGVIGDITTRAERGGLMGI
FQAGLLLPVALGPVIGGLLAGSLGWRAIFWFLAIYSAVFLLCLAVLLPETLRAVVANGSRLPSKLMARYPLEIYQ
KKTKVAWDRTMPLPEPAAKKRLDIAGPLRILISRQAAPIIFFLAIYYAVWQMSITAMSTLFATEYGLGEIQVGLT
FIANGVGSIVGTLITGKILDIDFRRVKQQHEARASSEDQFPLEKARLRLVPLFSLAQCLSILLFGWTIHYPRLVH
IAVPIISTFVTGWTAVSTQSVVMTYLVDVFHDRSAAASASLNLARCLFAAGGTSFVVPMIKGVGVGPAFTTCAAV
QLVALLGPVVQFRYGGVWRRQAEVKRRAFETGEA*
Coding >Hirsu2|3055
ATGGCACAACCAGCAGTCCCCGACGGGCAGCCTTACAGCATCTTCGACCCCCGACAGAAAGCATTGATCGTTCTC
GTCGTGTCCGTCGCCGCAACATTCTCCGGGTTCGCATCGAATATATACTTCCCCGCGCTTTCAGCCATTGCCGAC
GACATCGGCACCTCGATAGAGCTCGTCAACCTCACCGTCACGTTCTATCTCATCTTCCAGGGGCTGGCGCCCAGT
GTTTGGGGTCCTGTTTCGGACGTCAAGGGACGCCGGGTCGCGTACTGCTGCACCTTTGTCGTGTTCCTTGGCGCC
TGCGTCGGCCTGGCGGAGGCAAGGAACTACGCGACTCTGCTAGTGCTGCGATGCGTTCAGAGCGCCGGAAGTGCG
AGCACAGTCGCCATCGGGTCCGGCGTCATCGGGGACATCACCACGCGTGCCGAGCGAGGCGGCCTCATGGGCATC
TTCCAGGCCGGCTTGCTTCTGCCCGTCGCCCTGGGCCCCGTGATTGGCGGCCTTCTGGCCGGCTCCCTCGGCTGG
AGAGCCATCTTCTGGTTTCTGGCCATCTACAGCGCCGTCTTCCTGCTCTGCTTGGCCGTCTTGCTGCCCGAGACG
CTCAGGGCGGTCGTTGCCAACGGCAGCCGGCTGCCGTCGAAGCTGATGGCTCGATATCCCTTGGAAATCTACCAA
AAAAAGACCAAGGTCGCGTGGGACCGAACGATGCCGCTACCAGAGCCTGCGGCCAAGAAGCGGCTCGACATCGCC
GGCCCCTTGCGGATCCTGATCAGCAGGCAGGCCGCGCCTATCATATTCTTTCTCGCCATATACTACGCTGTCTGG
CAGATGAGCATCACTGCCATGTCCACTCTGTTCGCGACAGAATACGGACTTGGGGAGATTCAAGTCGGACTGACC
TTTATCGCAAACGGCGTCGGCTCTATCGTTGGCACTCTCATCACTGGGAAGATACTCGACATCGATTTTCGCCGC
GTCAAGCAACAGCATGAAGCCAGAGCGAGCTCGGAGGACCAATTCCCGCTGGAGAAGGCCCGCCTGCGCCTCGTC
CCGCTCTTTTCCTTGGCACAATGCCTGTCCATCCTCCTATTTGGCTGGACAATACATTATCCTCGCCTGGTTCAC
ATTGCGGTGCCCATCATATCCACCTTCGTTACAGGCTGGACTGCCGTTTCAACCCAGTCCGTCGTCATGACTTAC
CTCGTCGACGTCTTCCACGACCGCAGCGCGGCAGCAAGCGCGAGCCTCAACTTGGCGAGGTGTCTATTTGCCGCG
GGAGGGACTAGCTTCGTCGTGCCGATGATCAAGGGCGTCGGAGTCGGGCCAGCCTTTACTACTTGCGCCGCCGTG
CAGTTGGTTGCCCTGCTGGGCCCGGTCGTACAGTTCCGATACGGCGGTGTGTGGAGGCGGCAGGCAGAAGTGAAG
CGGCGGGCTTTCGAAACTGGGGAAGCCTAG
Transcript >Hirsu2|3055
ATGGCACAACCAGCAGTCCCCGACGGGCAGCCTTACAGCATCTTCGACCCCCGACAGAAAGCATTGATCGTTCTC
GTCGTGTCCGTCGCCGCAACATTCTCCGGGTTCGCATCGAATATATACTTCCCCGCGCTTTCAGCCATTGCCGAC
GACATCGGCACCTCGATAGAGCTCGTCAACCTCACCGTCACGTTCTATCTCATCTTCCAGGGGCTGGCGCCCAGT
GTTTGGGGTCCTGTTTCGGACGTCAAGGGACGCCGGGTCGCGTACTGCTGCACCTTTGTCGTGTTCCTTGGCGCC
TGCGTCGGCCTGGCGGAGGCAAGGAACTACGCGACTCTGCTAGTGCTGCGATGCGTTCAGAGCGCCGGAAGTGCG
AGCACAGTCGCCATCGGGTCCGGCGTCATCGGGGACATCACCACGCGTGCCGAGCGAGGCGGCCTCATGGGCATC
TTCCAGGCCGGCTTGCTTCTGCCCGTCGCCCTGGGCCCCGTGATTGGCGGCCTTCTGGCCGGCTCCCTCGGCTGG
AGAGCCATCTTCTGGTTTCTGGCCATCTACAGCGCCGTCTTCCTGCTCTGCTTGGCCGTCTTGCTGCCCGAGACG
CTCAGGGCGGTCGTTGCCAACGGCAGCCGGCTGCCGTCGAAGCTGATGGCTCGATATCCCTTGGAAATCTACCAA
AAAAAGACCAAGGTCGCGTGGGACCGAACGATGCCGCTACCAGAGCCTGCGGCCAAGAAGCGGCTCGACATCGCC
GGCCCCTTGCGGATCCTGATCAGCAGGCAGGCCGCGCCTATCATATTCTTTCTCGCCATATACTACGCTGTCTGG
CAGATGAGCATCACTGCCATGTCCACTCTGTTCGCGACAGAATACGGACTTGGGGAGATTCAAGTCGGACTGACC
TTTATCGCAAACGGCGTCGGCTCTATCGTTGGCACTCTCATCACTGGGAAGATACTCGACATCGATTTTCGCCGC
GTCAAGCAACAGCATGAAGCCAGAGCGAGCTCGGAGGACCAATTCCCGCTGGAGAAGGCCCGCCTGCGCCTCGTC
CCGCTCTTTTCCTTGGCACAATGCCTGTCCATCCTCCTATTTGGCTGGACAATACATTATCCTCGCCTGGTTCAC
ATTGCGGTGCCCATCATATCCACCTTCGTTACAGGCTGGACTGCCGTTTCAACCCAGTCCGTCGTCATGACTTAC
CTCGTCGACGTCTTCCACGACCGCAGCGCGGCAGCAAGCGCGAGCCTCAACTTGGCGAGGTGTCTATTTGCCGCG
GGAGGGACTAGCTTCGTCGTGCCGATGATCAAGGGCGTCGGAGTCGGGCCAGCCTTTACTACTTGCGCCGCCGTG
CAGTTGGTTGCCCTGCTGGGCCCGGTCGTACAGTTCCGATACGGCGGTGTGTGGAGGCGGCAGGCAGAAGTGAAG
CGGCGGGCTTTCGAAACTGGGGAAGCCTAG
Gene >Hirsu2|3055
ATGGCACAACCAGCAGTCCCCGACGGGCAGCCTTACAGCATCTTCGACCCCCGACAGAAAGCATTGATCGTTCTC
GTCGTGTCCGTCGCCGCAACATGTAAGCAGGCGTCTGCCACGCCATATTGTTCGGAACCGAAAGCTGACGACAGA
GCAGTCTCCGGGTTCGCATCGAATATATACTTCCCCGCGCTTTCAGCCATTGCCGACGACATCGGCACCTCGATA
GAGCTCGTCAACCTCACCGTCACGTTCTATCTCATCTTCCAGGGGCTGGCGCCCAGTGTTTGGGGTCCTGTTTCG
GACGTCAAGGGACGCCGGGTCGCGTACTGCTGCACCTTTGTCGTGTTCCTTGGCGCCTGCGTCGGCCTGGCGGAG
GCAAGGAACTACGCGACTCTGCTAGTGCTGCGATGCGTTCAGAGCGCCGGAAGTGCGAGCACAGTCGCCATCGGG
TCCGGCGTCATCGGGGACATCACCACGCGTGCCGAGCGAGGCGGCCTCATGGGCATCTTCCAGGCCGGCTTGCTT
CTGCCCGTCGCCCTGGGCCCCGTGATTGGCGGCCTTCTGGCCGGCTCCCTCGGCTGGAGAGCCATCTTCTGGTTT
CTGGCCATCTACAGCGCCGTCTTCCTGCTCTGCTTGGCCGTCTTGCTGCCCGAGACGCTCAGGGCGGTCGTTGCC
AACGGCAGCCGGCTGCCGTCGAAGCTGATGGCTCGATATCCCTTGGAAATCTACCAAAAAAAGACCAAGGTCGCG
TGGGACCGAACGATGCCGCTACCAGAGCCTGCGGCCAAGAAGCGGCTCGACATCGCCGGCCCCTTGCGGATCCTG
ATCAGCAGGCAGGCCGCGCCTATCATATTCTTTCTCGCCATATACTACGCTGTCTGGCAGATGAGCATCACTGCC
ATGTCCACTCTGTTCGCGACAGAATACGGACTTGGGGAGATTCAAGTCGGACTGACCTTTATCGCAAACGGCGTC
GGCTCTATCGTTGGCACTCTCATCACTGGGAAGATACTCGACATCGATTTTCGCCGCGTCAAGCAACAGCATGAA
GCCAGAGCGAGCTCGGAGGACCAATTCCCGCTGGAGAAGGCCCGCCTGCGCCTCGTCCCGCTCTTTTCCTTGGCA
CAATGCCTGTCCATCCTCCTATTTGGCTGGACAATACATTATCCTCGCCTGGTTCACATTGCGGTGCCCATCATA
TCCACCTTCGTTACAGGCTGGACTGCCGTTTCAACCCAGTCCGTCGTCATGACTTACCTCGTCGACGTCTTCCAC
GACCGCAGCGCGGCAGCAAGCGCGAGCCTCAACTTGGCGAGGTGTCTATTTGCCGCGGGAGGGACTAGCTTCGTC
GTGCCGATGATCAAGGGCGTCGGAGTCGGGCCAGCCTTTACTACTTGCGCCGCCGTGCAGTTGGTTGCCCTGCTG
GGCCCGGTCGTACAGTTCCGATACGGCGGTGTGTGGAGGCGGCAGGCAGAAGTGAAGCGGCGGGCTTTCGAAACT
GGGGAAGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail