Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3037
Gene name
LocationContig_1772:1495..2746
Strand-
Gene length (bp)1251
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.3E-05 292 314
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.1E-03 320 344
PF12874 zf-met Zinc-finger of C2H2 type 1.8E-05 293 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA1|YL8J_SCHPO Zinc finger protein C25B8.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.19c PE=3 SV=2 291 344 1.0E-15
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 285 347 3.0E-13
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 257 344 7.0E-13
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 285 347 1.0E-12
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 289 354 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA1|YL8J_SCHPO Zinc finger protein C25B8.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.19c PE=3 SV=2 291 344 1.0E-15
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 285 347 3.0E-13
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 257 344 7.0E-13
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 285 347 1.0E-12
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 289 354 2.0E-12
sp|P22227|ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus GN=Zfp42 PE=1 SV=1 290 349 2.0E-12
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 285 347 2.0E-12
sp|Q12145|YP013_YEAST Zinc finger protein YPR013C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR013C PE=1 SV=1 286 345 3.0E-12
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 292 347 4.0E-12
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 292 347 4.0E-12
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 292 347 4.0E-12
sp|Q8ST83|PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster GN=pho PE=1 SV=2 292 347 5.0E-12
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 266 344 6.0E-12
sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 290 349 6.0E-12
sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens GN=YY2 PE=2 SV=1 292 347 7.0E-12
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 285 347 7.0E-12
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 292 347 7.0E-12
sp|Q00899|TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus GN=Yy1 PE=1 SV=1 292 347 8.0E-12
sp|E7ETH6|Z587B_HUMAN Zinc finger protein 587B OS=Homo sapiens GN=ZNF587B PE=1 SV=1 236 353 2.0E-11
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 285 347 2.0E-11
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 285 347 2.0E-11
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 289 344 3.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 289 344 3.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 289 344 3.0E-11
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 289 347 4.0E-11
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 289 344 4.0E-11
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 289 347 4.0E-11
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 285 347 4.0E-11
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 297 347 4.0E-11
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 289 347 5.0E-11
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 289 344 5.0E-11
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 289 344 6.0E-11
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 291 344 6.0E-11
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 289 344 6.0E-11
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 266 344 6.0E-11
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 276 346 7.0E-11
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 288 346 8.0E-11
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 289 351 8.0E-11
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 289 351 8.0E-11
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 289 344 1.0E-10
sp|Q9BWW7|SCRT1_HUMAN Transcriptional repressor scratch 1 OS=Homo sapiens GN=SCRT1 PE=1 SV=1 291 344 1.0E-10
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 259 346 1.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 289 351 1.0E-10
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 290 347 2.0E-10
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 259 345 2.0E-10
sp|Q8BTH6|SCRT2_MOUSE Transcriptional repressor scratch 2 OS=Mus musculus GN=Scrt2 PE=2 SV=2 291 344 2.0E-10
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 288 347 2.0E-10
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 297 347 2.0E-10
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 290 347 2.0E-10
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 285 346 2.0E-10
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 289 351 2.0E-10
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 289 347 2.0E-10
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 297 347 2.0E-10
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 289 344 2.0E-10
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 290 347 2.0E-10
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 289 352 2.0E-10
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 289 352 3.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 289 353 3.0E-10
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 289 352 3.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 289 353 3.0E-10
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 294 353 3.0E-10
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 288 346 3.0E-10
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 291 345 3.0E-10
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 291 345 3.0E-10
sp|Q9NQ03|SCRT2_HUMAN Transcriptional repressor scratch 2 OS=Homo sapiens GN=SCRT2 PE=2 SV=3 291 344 3.0E-10
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 289 352 3.0E-10
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 289 352 3.0E-10
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 291 345 4.0E-10
sp|Q12531|YP015_YEAST Zinc finger protein YPR015C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR015C PE=3 SV=1 274 347 4.0E-10
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 291 345 5.0E-10
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 291 344 5.0E-10
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 289 347 5.0E-10
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 292 348 5.0E-10
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 288 344 7.0E-10
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 288 344 7.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 289 353 7.0E-10
sp|Q9H0D2|ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens GN=ZNF541 PE=2 SV=3 284 346 8.0E-10
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 294 347 8.0E-10
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 293 347 8.0E-10
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 288 347 9.0E-10
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 297 347 1.0E-09
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 276 347 1.0E-09
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 269 347 1.0E-09
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 279 344 1.0E-09
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 289 347 1.0E-09
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 289 347 2.0E-09
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 283 347 2.0E-09
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 297 347 2.0E-09
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 261 349 2.0E-09
sp|Q9QX96|SALL2_MOUSE Sal-like protein 2 OS=Mus musculus GN=Sall2 PE=1 SV=2 283 345 2.0E-09
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 281 347 2.0E-09
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 278 344 2.0E-09
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 290 347 2.0E-09
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 261 349 2.0E-09
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 277 345 2.0E-09
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 289 344 2.0E-09
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 281 347 2.0E-09
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 297 349 2.0E-09
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 233 342 2.0E-09
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 290 345 2.0E-09
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 297 349 2.0E-09
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 281 347 2.0E-09
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 297 349 2.0E-09
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 293 352 3.0E-09
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 291 344 3.0E-09
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 287 345 3.0E-09
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 289 347 3.0E-09
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 290 347 3.0E-09
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 289 347 3.0E-09
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 3.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 289 344 3.0E-09
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 290 347 3.0E-09
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 3.0E-09
sp|Q3UH06|RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus GN=Rreb1 PE=1 SV=2 282 356 3.0E-09
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 289 346 3.0E-09
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 289 347 3.0E-09
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 247 347 3.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 289 344 3.0E-09
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 281 347 3.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 289 344 3.0E-09
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 287 347 4.0E-09
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 289 349 4.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 289 344 4.0E-09
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 289 349 4.0E-09
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 247 347 4.0E-09
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 293 347 4.0E-09
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 276 344 4.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 289 344 4.0E-09
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 287 347 4.0E-09
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 289 342 4.0E-09
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 274 347 4.0E-09
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 289 349 4.0E-09
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 287 349 4.0E-09
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 289 349 4.0E-09
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 281 347 4.0E-09
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 290 350 5.0E-09
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 283 347 5.0E-09
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 289 347 5.0E-09
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 290 350 5.0E-09
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 277 346 5.0E-09
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 261 349 5.0E-09
sp|Q9Y467|SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens GN=SALL2 PE=1 SV=4 291 345 5.0E-09
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 287 349 5.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 289 344 5.0E-09
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 292 355 5.0E-09
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 292 348 5.0E-09
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 278 346 5.0E-09
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 289 346 5.0E-09
sp|Q0GGX2|ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus GN=Znf541 PE=1 SV=1 284 346 5.0E-09
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 293 347 5.0E-09
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 289 349 5.0E-09
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 289 347 6.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 289 347 6.0E-09
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 278 346 6.0E-09
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 289 342 6.0E-09
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 289 342 6.0E-09
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 289 344 6.0E-09
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 289 342 6.0E-09
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 289 360 6.0E-09
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 289 342 6.0E-09
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 289 342 6.0E-09
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 287 347 7.0E-09
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 289 342 7.0E-09
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 289 349 7.0E-09
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 281 346 7.0E-09
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 289 357 7.0E-09
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 289 360 7.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 287 347 7.0E-09
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 290 346 7.0E-09
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 248 348 7.0E-09
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 289 346 7.0E-09
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 294 354 7.0E-09
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 289 345 8.0E-09
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 281 344 8.0E-09
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 282 354 8.0E-09
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 297 347 8.0E-09
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 287 347 8.0E-09
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 297 347 8.0E-09
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 289 346 8.0E-09
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 8.0E-09
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 287 347 8.0E-09
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 289 347 9.0E-09
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 279 347 9.0E-09
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 281 344 9.0E-09
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 297 347 9.0E-09
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 292 347 9.0E-09
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 297 347 9.0E-09
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 294 347 9.0E-09
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 287 347 9.0E-09
sp|Q3UH06|RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus GN=Rreb1 PE=1 SV=2 292 350 1.0E-08
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 293 347 1.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 281 347 1.0E-08
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 289 344 1.0E-08
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 289 344 1.0E-08
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 289 346 1.0E-08
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 289 346 1.0E-08
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 289 346 1.0E-08
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 297 347 1.0E-08
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 292 348 1.0E-08
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 290 344 1.0E-08
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 289 357 1.0E-08
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 283 352 1.0E-08
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 290 344 1.0E-08
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 290 344 1.0E-08
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 277 347 1.0E-08
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 289 347 1.0E-08
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 297 347 1.0E-08
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 292 348 1.0E-08
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 290 344 1.0E-08
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 290 344 1.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 1.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 1.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 279 347 1.0E-08
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 289 347 1.0E-08
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 283 352 1.0E-08
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 283 352 1.0E-08
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 297 347 1.0E-08
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 290 344 1.0E-08
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 292 347 1.0E-08
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 297 347 1.0E-08
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 297 347 1.0E-08
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 297 347 1.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 293 347 1.0E-08
sp|Q7K0S9|GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster GN=sug PE=2 SV=1 287 344 1.0E-08
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 289 357 1.0E-08
sp|P39806|SALM_DROVI Homeotic protein spalt-major OS=Drosophila virilis GN=salm PE=2 SV=1 291 344 1.0E-08
sp|P39770|SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster GN=salm PE=1 SV=3 291 344 1.0E-08
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 278 347 1.0E-08
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 289 341 1.0E-08
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 297 347 1.0E-08
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 284 347 1.0E-08
sp|Q9HAH1|ZN556_HUMAN Zinc finger protein 556 OS=Homo sapiens GN=ZNF556 PE=2 SV=1 283 353 1.0E-08
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 275 345 2.0E-08
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 275 345 2.0E-08
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 275 345 2.0E-08
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 292 344 2.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 349 2.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 281 347 2.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 2.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 347 2.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 2.0E-08
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 292 348 2.0E-08
sp|P39806|SALM_DROVI Homeotic protein spalt-major OS=Drosophila virilis GN=salm PE=2 SV=1 292 345 2.0E-08
sp|P39770|SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster GN=salm PE=1 SV=3 281 345 2.0E-08
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 297 347 2.0E-08
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 290 358 2.0E-08
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 290 344 2.0E-08
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 278 347 2.0E-08
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 297 347 2.0E-08
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 280 347 2.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 293 347 2.0E-08
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 283 349 2.0E-08
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 289 348 2.0E-08
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 289 342 2.0E-08
sp|Q567C6|ZN367_DANRE Zinc finger protein 367 OS=Danio rerio GN=znf367 PE=2 SV=1 293 347 2.0E-08
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 282 360 2.0E-08
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 292 350 2.0E-08
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 278 347 2.0E-08
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 278 347 2.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 281 347 2.0E-08
sp|O57415|RREB1_CHICK Ras-responsive element-binding protein 1 OS=Gallus gallus GN=RREB1 PE=2 SV=2 292 354 2.0E-08
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 278 347 2.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 253 347 2.0E-08
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 278 347 2.0E-08
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 285 347 2.0E-08
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 289 347 2.0E-08
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 278 347 2.0E-08
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 292 347 2.0E-08
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 280 348 2.0E-08
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 289 341 2.0E-08
sp|P19382|SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis GN=snai1 PE=1 SV=1 294 354 2.0E-08
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 283 352 2.0E-08
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 289 342 2.0E-08
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 289 347 2.0E-08
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 293 347 2.0E-08
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 283 352 2.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 289 347 2.0E-08
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 289 353 2.0E-08
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 294 347 2.0E-08
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 289 347 2.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 289 347 2.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 283 349 2.0E-08
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 289 347 2.0E-08
sp|Q0VDT2|ZN367_MOUSE Zinc finger protein 367 OS=Mus musculus GN=Znf367 PE=1 SV=2 293 347 2.0E-08
sp|Q5U2Z0|ZN367_RAT Zinc finger protein 367 OS=Rattus norvegicus GN=Znf367 PE=2 SV=1 293 347 2.0E-08
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 275 345 3.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 349 3.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 344 3.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 3.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 3.0E-08
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 292 347 3.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 289 347 3.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 292 347 3.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 293 355 3.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 347 3.0E-08
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 297 349 3.0E-08
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 289 347 3.0E-08
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 289 342 3.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 221 347 3.0E-08
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 283 353 3.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 262 354 3.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 287 347 3.0E-08
sp|P25932|ESCA_DROME Protein escargot OS=Drosophila melanogaster GN=esg PE=1 SV=2 293 344 3.0E-08
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 289 347 3.0E-08
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 290 347 3.0E-08
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 289 347 3.0E-08
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 287 348 3.0E-08
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 290 344 3.0E-08
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 289 347 3.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 290 347 3.0E-08
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 283 352 3.0E-08
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 283 347 3.0E-08
sp|Q6INV8|Z652B_XENLA Zinc finger protein 652-B OS=Xenopus laevis GN=znf652-b PE=2 SV=1 290 347 3.0E-08
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 297 347 3.0E-08
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 290 349 3.0E-08
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 297 349 3.0E-08
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 289 347 4.0E-08
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 287 347 4.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 4.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 4.0E-08
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 281 347 4.0E-08
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 286 347 4.0E-08
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 294 349 4.0E-08
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 289 359 4.0E-08
sp|Q6GNP2|Z652A_XENLA Zinc finger protein 652-A OS=Xenopus laevis GN=znf652-a PE=2 SV=1 290 347 4.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 290 347 4.0E-08
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 293 347 4.0E-08
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 297 347 4.0E-08
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 294 344 4.0E-08
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 258 347 4.0E-08
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 297 347 4.0E-08
sp|P08044|SNAI_DROME Protein snail OS=Drosophila melanogaster GN=sna PE=1 SV=2 293 359 4.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 283 346 4.0E-08
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 297 347 4.0E-08
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 294 344 4.0E-08
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 294 344 4.0E-08
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 282 344 4.0E-08
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 258 347 4.0E-08
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 294 344 4.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 293 347 4.0E-08
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 283 347 4.0E-08
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 283 347 4.0E-08
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 289 347 4.0E-08
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 289 342 4.0E-08
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 289 347 4.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 280 353 4.0E-08
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 285 347 4.0E-08
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 281 347 4.0E-08
sp|A6QR00|ZN526_BOVIN Zinc finger protein 526 OS=Bos taurus GN=ZNF526 PE=2 SV=1 289 346 4.0E-08
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 289 347 5.0E-08
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 287 347 5.0E-08
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 288 347 5.0E-08
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 288 347 5.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 249 347 5.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 347 5.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 278 347 5.0E-08
sp|Q9UFB7|ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens GN=ZBTB47 PE=2 SV=3 290 347 5.0E-08
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 294 344 5.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 234 349 5.0E-08
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 285 347 5.0E-08
sp|Q8BI66|ZN526_MOUSE Zinc finger protein 526 OS=Mus musculus GN=Znf526 PE=2 SV=1 289 346 5.0E-08
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 292 348 5.0E-08
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 283 347 5.0E-08
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 297 347 5.0E-08
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 293 347 5.0E-08
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 297 347 5.0E-08
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 285 347 5.0E-08
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 283 352 5.0E-08
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 294 347 5.0E-08
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 275 344 5.0E-08
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 297 347 5.0E-08
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 289 347 5.0E-08
sp|A1L1J6|ZN652_RAT Zinc finger protein 652 OS=Rattus norvegicus GN=Znf652 PE=1 SV=1 290 347 5.0E-08
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 294 346 6.0E-08
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 289 346 6.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 6.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 278 347 6.0E-08
sp|O57415|RREB1_CHICK Ras-responsive element-binding protein 1 OS=Gallus gallus GN=RREB1 PE=2 SV=2 289 345 6.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 347 6.0E-08
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 283 347 6.0E-08
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 6.0E-08
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 289 347 6.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 289 347 6.0E-08
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 287 347 6.0E-08
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 290 349 6.0E-08
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 297 347 6.0E-08
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 297 347 6.0E-08
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 286 356 6.0E-08
sp|Q5DU09|ZN652_MOUSE Zinc finger protein 652 OS=Mus musculus GN=Znf652 PE=1 SV=2 290 347 6.0E-08
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 283 347 6.0E-08
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 288 347 6.0E-08
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 283 349 6.0E-08
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 297 347 6.0E-08
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 283 353 6.0E-08
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 294 352 6.0E-08
sp|Q9Y2D9|ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens GN=ZNF652 PE=1 SV=3 290 347 6.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 281 347 7.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 7.0E-08
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 285 344 7.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 293 355 7.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 344 7.0E-08
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 292 349 7.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 287 347 7.0E-08
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 283 347 7.0E-08
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 287 347 7.0E-08
sp|Q8TF50|ZN526_HUMAN Zinc finger protein 526 OS=Homo sapiens GN=ZNF526 PE=2 SV=2 289 346 7.0E-08
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 287 347 7.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 277 347 7.0E-08
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 280 347 7.0E-08
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 283 353 7.0E-08
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 290 347 7.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 292 347 7.0E-08
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 294 347 7.0E-08
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 292 349 7.0E-08
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 283 353 7.0E-08
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 283 353 7.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 289 344 7.0E-08
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 297 347 8.0E-08
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 293 347 8.0E-08
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 288 347 8.0E-08
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 290 346 8.0E-08
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 287 347 8.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 8.0E-08
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 8.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 293 347 8.0E-08
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 283 347 8.0E-08
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 283 347 8.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 289 349 8.0E-08
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 270 347 8.0E-08
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 292 349 8.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 275 347 8.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 293 347 8.0E-08
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 292 349 8.0E-08
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 294 347 8.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 288 347 8.0E-08
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 289 350 8.0E-08
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 289 347 8.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 275 347 8.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 288 347 8.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 289 346 8.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 344 9.0E-08
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 278 347 9.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 283 346 9.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 293 347 9.0E-08
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 293 347 9.0E-08
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 278 347 9.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 290 345 9.0E-08
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 289 347 9.0E-08
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 289 347 9.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 289 347 9.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 289 347 9.0E-08
sp|Q7RTV3|ZN367_HUMAN Zinc finger protein 367 OS=Homo sapiens GN=ZNF367 PE=1 SV=1 293 347 9.0E-08
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 257 348 9.0E-08
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 262 346 9.0E-08
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 283 352 9.0E-08
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 289 347 9.0E-08
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 289 347 9.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 290 345 9.0E-08
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 289 342 9.0E-08
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 293 346 9.0E-08
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 283 347 9.0E-08
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 282 347 9.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 283 350 1.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 294 346 1.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 1.0E-07
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 294 347 1.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 281 347 1.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 281 353 1.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 347 1.0E-07
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 291 352 1.0E-07
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 291 352 1.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 1.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 1.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 289 346 1.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 1.0E-07
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 278 344 1.0E-07
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 292 347 1.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 289 347 1.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 347 1.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 289 347 1.0E-07
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 283 347 1.0E-07
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 253 347 1.0E-07
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 283 347 1.0E-07
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 283 347 1.0E-07
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 289 347 1.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 239 347 1.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 283 347 1.0E-07
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 289 342 1.0E-07
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 290 347 1.0E-07
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 289 347 1.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 290 347 1.0E-07
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 279 348 1.0E-07
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 289 347 1.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 289 347 1.0E-07
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 289 347 1.0E-07
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 292 347 1.0E-07
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 292 348 1.0E-07
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 283 347 1.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 288 347 1.0E-07
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 292 349 1.0E-07
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 289 342 1.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 289 347 1.0E-07
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 290 344 1.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 289 347 1.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 283 344 1.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 289 347 1.0E-07
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 292 347 1.0E-07
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 294 344 1.0E-07
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 289 347 1.0E-07
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 289 347 1.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 290 347 1.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 289 347 1.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 292 346 1.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 1.0E-07
sp|Q80VM4|ZN579_MOUSE Zinc finger protein 579 OS=Mus musculus GN=Znf579 PE=1 SV=1 290 344 1.0E-07
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 281 347 1.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 283 347 1.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 289 346 1.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 280 347 1.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 281 347 1.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 279 344 1.0E-07
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 294 347 1.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 289 346 1.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 290 347 1.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 292 347 1.0E-07
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 289 347 1.0E-07
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 289 347 1.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 292 346 1.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 1.0E-07
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 283 347 1.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 294 347 1.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 292 349 1.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 262 346 1.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 292 349 1.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 297 347 1.0E-07
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 289 347 1.0E-07
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 289 347 1.0E-07
sp|Q9UK11|ZN223_HUMAN Zinc finger protein 223 OS=Homo sapiens GN=ZNF223 PE=1 SV=2 289 347 1.0E-07
sp|Q9UK12|ZN222_HUMAN Zinc finger protein 222 OS=Homo sapiens GN=ZNF222 PE=2 SV=2 290 344 1.0E-07
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 280 347 1.0E-07
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 289 347 2.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 289 347 2.0E-07
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 261 345 2.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 2.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 2.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 347 2.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 281 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 287 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 347 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 287 347 2.0E-07
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 292 348 2.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 2.0E-07
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 283 344 2.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 289 347 2.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 283 347 2.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 281 347 2.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 289 347 2.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 347 2.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 289 349 2.0E-07
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 292 347 2.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 289 347 2.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 283 344 2.0E-07
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 289 347 2.0E-07
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 292 347 2.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 289 344 2.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 289 347 2.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 285 347 2.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 289 347 2.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 297 346 2.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 293 348 2.0E-07
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 289 353 2.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 297 346 2.0E-07
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 289 346 2.0E-07
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 293 347 2.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 276 352 2.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 288 347 2.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 289 347 2.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 289 347 2.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 293 347 2.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 117 347 2.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 283 347 2.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 294 347 2.0E-07
sp|Q8NAF0|ZN579_HUMAN Zinc finger protein 579 OS=Homo sapiens GN=ZNF579 PE=1 SV=2 290 344 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 284 347 2.0E-07
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 217 352 2.0E-07
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 280 347 2.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 347 2.0E-07
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 280 347 2.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 257 347 2.0E-07
sp|Q5T1R4|ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens GN=HIVEP3 PE=2 SV=1 291 344 2.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 292 353 2.0E-07
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 280 347 2.0E-07
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 289 346 2.0E-07
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 289 346 2.0E-07
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 289 329 2.0E-07
sp|A2A884|ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus GN=Hivep3 PE=1 SV=1 291 344 2.0E-07
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 289 346 2.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 297 346 2.0E-07
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 289 347 2.0E-07
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 293 347 2.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 280 347 2.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 290 347 2.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 261 347 2.0E-07
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 292 346 2.0E-07
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 283 346 2.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 290 347 2.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 289 347 2.0E-07
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 289 342 2.0E-07
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 289 347 2.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 287 344 2.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 297 346 2.0E-07
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 290 348 2.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 292 347 2.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 283 347 2.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 297 346 2.0E-07
sp|Q6ZQV5|ZN788_HUMAN Zinc finger protein 788 OS=Homo sapiens GN=ZNF788 PE=2 SV=2 284 347 2.0E-07
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 285 347 2.0E-07
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 274 346 2.0E-07
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 290 347 2.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 289 347 2.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 289 347 2.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 287 346 2.0E-07
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 289 345 2.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 287 347 2.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 297 346 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 2.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 293 347 2.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 297 346 2.0E-07
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 289 347 2.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 261 346 2.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 237 347 2.0E-07
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 292 348 2.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 297 346 2.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 293 353 2.0E-07
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 289 347 3.0E-07
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 289 347 3.0E-07
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 289 347 3.0E-07
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 289 347 3.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 288 347 3.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 3.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 294 347 3.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 287 347 3.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 344 3.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 347 3.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 3.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 254 344 3.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 281 347 3.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 293 348 3.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 347 3.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 287 347 3.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 283 347 3.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 289 344 3.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 3.0E-07
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 294 346 3.0E-07
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 292 348 3.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 289 347 3.0E-07
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 289 347 3.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 283 344 3.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 292 347 3.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 347 3.0E-07
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 283 344 3.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 289 347 3.0E-07
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 271 352 3.0E-07
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 287 344 3.0E-07
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 294 352 3.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 280 344 3.0E-07
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 289 347 3.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 294 346 3.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 287 347 3.0E-07
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 285 346 3.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 287 347 3.0E-07
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 285 346 3.0E-07
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 289 347 3.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 275 347 3.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 360 3.0E-07
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 290 349 3.0E-07
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 289 346 3.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 287 347 3.0E-07
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 293 347 3.0E-07
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 285 346 3.0E-07
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 289 347 4.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 287 347 4.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 4.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 289 347 4.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 289 347 4.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 281 347 4.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 289 344 4.0E-07
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 289 344 4.0E-07
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 294 346 4.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 254 346 4.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 258 353 4.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 289 347 4.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 289 347 4.0E-07
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 285 347 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 257 347 4.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 289 348 4.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 289 347 4.0E-07
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 289 347 5.0E-07
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 289 347 5.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 5.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 353 5.0E-07
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 289 347 5.0E-07
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 292 347 5.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 283 347 5.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 287 347 5.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 283 344 5.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 289 347 5.0E-07
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 289 347 5.0E-07
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 294 346 5.0E-07
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 283 347 5.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 254 344 5.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 287 347 5.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 289 347 5.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 285 347 5.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 293 347 5.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 294 346 5.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 289 347 5.0E-07
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 289 347 6.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 289 347 6.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 6.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 6.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 6.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 6.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 285 347 6.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 289 347 6.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 347 6.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 283 344 6.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 283 347 6.0E-07
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 287 347 6.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 289 344 6.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 289 347 6.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 282 347 6.0E-07
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 289 347 6.0E-07
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 344 7.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 257 344 7.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 353 7.0E-07
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 283 347 7.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 283 344 7.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 289 347 7.0E-07
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 287 348 7.0E-07
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 283 347 7.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 289 344 7.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 349 7.0E-07
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 293 347 7.0E-07
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 289 347 8.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 289 344 8.0E-07
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 294 345 8.0E-07
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 292 353 8.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 347 8.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 347 8.0E-07
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 283 344 8.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 283 347 8.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 287 347 8.0E-07
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 297 346 8.0E-07
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 297 346 8.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 289 347 8.0E-07
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 294 347 8.0E-07
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 294 347 8.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 8.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 8.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 278 347 8.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 289 347 8.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 289 347 8.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 9.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 289 347 9.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 289 347 9.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 347 9.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 294 344 9.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 294 347 9.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 292 347 9.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 289 347 9.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 289 347 9.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 289 347 9.0E-07
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 9.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 269 347 9.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 292 347 9.0E-07
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 277 346 9.0E-07
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 289 344 9.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 289 347 1.0E-06
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 279 347 1.0E-06
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 287 347 1.0E-06
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 275 348 1.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 1.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 287 347 1.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 289 347 1.0E-06
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 287 347 1.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 289 347 1.0E-06
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 289 347 1.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 289 347 1.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 289 347 1.0E-06
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 294 346 1.0E-06
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 283 345 1.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 283 345 1.0E-06
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 283 344 1.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 289 353 1.0E-06
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 283 344 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 285 347 1.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 297 344 1.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 289 344 1.0E-06
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 294 346 1.0E-06
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 293 347 1.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 289 360 1.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 289 347 1.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 347 1.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 275 347 1.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 289 347 1.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 278 347 1.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 283 347 1.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 281 347 1.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 283 344 1.0E-06
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 289 347 1.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 289 347 1.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 289 346 1.0E-06
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 283 344 1.0E-06
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 289 346 1.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 287 347 1.0E-06
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 289 344 1.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 293 347 1.0E-06
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 294 344 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 289 347 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 289 347 1.0E-06
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 294 344 1.0E-06
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 289 347 1.0E-06
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 1.0E-06
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 289 347 1.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 281 348 1.0E-06
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 289 347 1.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 294 347 1.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 283 347 1.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 283 347 1.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 289 347 1.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 294 347 1.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 283 347 1.0E-06
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 289 347 1.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 284 347 1.0E-06
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 289 347 1.0E-06
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 289 347 1.0E-06
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 289 347 1.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 289 347 1.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 285 347 1.0E-06
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 289 347 1.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 287 347 1.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 269 346 1.0E-06
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 283 347 1.0E-06
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 289 347 1.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 237 347 1.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 347 1.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 347 1.0E-06
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 297 347 1.0E-06
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 280 347 1.0E-06
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 283 346 1.0E-06
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 289 347 1.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 283 347 1.0E-06
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 289 344 1.0E-06
sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens GN=YY2 PE=2 SV=1 297 344 2.0E-06
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 297 347 2.0E-06
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 297 347 2.0E-06
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 293 347 2.0E-06
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 285 344 2.0E-06
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 285 345 2.0E-06
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 287 344 2.0E-06
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 287 347 2.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 289 347 2.0E-06
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 287 344 2.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 346 2.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 289 347 2.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 287 347 2.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 292 349 2.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 257 347 2.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 289 347 2.0E-06
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 280 347 2.0E-06
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 289 346 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 287 347 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 2.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 287 347 2.0E-06
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 294 346 2.0E-06
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 294 346 2.0E-06
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 294 346 2.0E-06
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 280 347 2.0E-06
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 294 349 2.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 255 344 2.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 289 347 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 344 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 344 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 2.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 2.0E-06
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 283 344 2.0E-06
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 292 347 2.0E-06
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 280 347 2.0E-06
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 290 349 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 285 347 2.0E-06
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 278 347 2.0E-06
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 289 348 2.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 257 344 2.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 289 347 2.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 289 347 2.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 293 347 2.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 289 347 2.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 289 347 2.0E-06
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 292 347 2.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 297 344 2.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 289 347 2.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 289 353 2.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 297 344 2.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 285 349 2.0E-06
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 289 347 2.0E-06
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 290 348 2.0E-06
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 294 346 2.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 281 344 2.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 289 347 2.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 289 347 2.0E-06
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 283 352 2.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 277 347 2.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 283 347 2.0E-06
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 275 348 2.0E-06
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 294 347 2.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 293 347 2.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 283 347 2.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 293 347 2.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 283 347 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 290 346 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 280 347 2.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 289 346 2.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 281 347 2.0E-06
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 289 347 2.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 277 347 2.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 283 347 2.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 289 347 2.0E-06
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 287 347 2.0E-06
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 288 347 2.0E-06
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 287 346 2.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 289 347 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 289 347 2.0E-06
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 293 347 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 289 347 2.0E-06
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 289 346 2.0E-06
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 2.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 289 347 2.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 283 347 2.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 289 344 2.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 290 347 2.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 283 344 2.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 283 346 2.0E-06
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 283 347 2.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 289 347 2.0E-06
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 289 346 2.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 289 346 2.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 283 351 2.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 283 347 2.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 2.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 2.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 2.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 290 345 2.0E-06
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 287 347 2.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 283 344 2.0E-06
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 290 347 2.0E-06
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 290 347 2.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 287 347 3.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 287 347 3.0E-06
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 280 347 3.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 294 347 3.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 287 347 3.0E-06
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 294 349 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 344 3.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 292 347 3.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 292 347 3.0E-06
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 285 347 3.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 292 347 3.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 344 3.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 346 3.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 3.0E-06
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 283 345 3.0E-06
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 283 345 3.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 284 347 3.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 289 347 3.0E-06
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 283 344 3.0E-06
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 289 347 3.0E-06
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 283 344 3.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 287 346 3.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 289 347 3.0E-06
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 281 347 3.0E-06
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 283 352 3.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 289 344 3.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 270 347 3.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 289 353 3.0E-06
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 283 352 3.0E-06
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 280 347 3.0E-06
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 283 352 3.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 253 347 3.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 270 347 3.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 281 347 3.0E-06
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 293 347 3.0E-06
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 297 344 3.0E-06
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 280 342 3.0E-06
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 296 344 3.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 289 347 3.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 289 347 3.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 289 347 3.0E-06
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 296 344 3.0E-06
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 296 344 3.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 289 348 3.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 289 347 3.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 289 344 3.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 283 347 3.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 289 344 3.0E-06
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 252 344 3.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 289 347 3.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 3.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 289 347 3.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 289 347 3.0E-06
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 287 346 3.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 294 346 3.0E-06
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 290 347 3.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 290 345 3.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 3.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 287 347 3.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 289 347 3.0E-06
sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 297 351 4.0E-06
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 289 347 4.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 292 349 4.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 285 347 4.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 347 4.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 4.0E-06
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 283 347 4.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 344 4.0E-06
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 283 347 4.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 4.0E-06
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 290 347 4.0E-06
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 289 348 4.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 283 347 4.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 281 347 4.0E-06
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 289 344 4.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 293 347 4.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 287 347 4.0E-06
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 292 347 4.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 289 347 4.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 289 347 4.0E-06
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 283 356 4.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 289 347 4.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 292 347 4.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 292 359 4.0E-06
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 283 344 4.0E-06
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 283 344 4.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 287 347 4.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 293 347 4.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 289 352 4.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 283 344 4.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 292 347 4.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 296 344 4.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 4.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 294 347 4.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 289 344 4.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 4.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 290 347 4.0E-06
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 296 344 4.0E-06
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 296 344 4.0E-06
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 283 347 4.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 290 345 4.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 290 345 4.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 292 344 4.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 290 345 4.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 294 347 4.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 289 347 4.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 287 347 4.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 287 347 4.0E-06
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 297 347 5.0E-06
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 289 347 5.0E-06
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 289 347 5.0E-06
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 289 345 5.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 283 347 5.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 352 5.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 283 347 5.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 287 347 5.0E-06
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 283 347 5.0E-06
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 283 347 5.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 289 345 5.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 283 347 5.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 283 346 5.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 289 346 5.0E-06
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 283 344 5.0E-06
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 294 347 5.0E-06
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 283 344 5.0E-06
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 283 352 5.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 289 347 5.0E-06
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 5.0E-06
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 289 347 5.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 258 347 5.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 289 347 5.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 289 347 5.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 293 347 5.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 289 346 5.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 289 346 5.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 297 347 5.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 290 347 5.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 290 344 5.0E-06
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 289 345 5.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 284 347 5.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 354 5.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 297 347 5.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 297 347 5.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 287 347 5.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 287 347 5.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 289 347 5.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 294 347 5.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 292 347 5.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 276 347 5.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 292 356 5.0E-06
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 290 347 6.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 283 344 6.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 347 6.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 289 347 6.0E-06
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 287 347 6.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 289 347 6.0E-06
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 292 347 6.0E-06
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 287 347 6.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 289 347 6.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 281 347 6.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 289 347 6.0E-06
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 283 344 6.0E-06
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 279 344 6.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 289 344 6.0E-06
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 283 347 6.0E-06
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 283 344 6.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 251 347 6.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 258 347 6.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 289 347 6.0E-06
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 289 346 6.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 289 347 6.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 281 347 6.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 6.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 290 347 6.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 6.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 6.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 289 346 6.0E-06
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 289 347 6.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 290 356 6.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 290 356 6.0E-06
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 294 347 6.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 289 347 6.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 294 347 6.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 284 347 6.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 269 346 6.0E-06
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 292 347 6.0E-06
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 289 344 7.0E-06
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 289 347 7.0E-06
sp|Q9QX96|SALL2_MOUSE Sal-like protein 2 OS=Mus musculus GN=Sall2 PE=1 SV=2 292 345 7.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 289 347 7.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 289 354 7.0E-06
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 287 347 7.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 283 347 7.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 344 7.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 7.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 283 347 7.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 294 347 7.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 289 346 7.0E-06
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 289 344 7.0E-06
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 287 347 7.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 292 347 7.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 288 347 7.0E-06
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 279 347 7.0E-06
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 280 347 7.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 289 354 7.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 285 347 7.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 283 347 7.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 289 347 7.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 283 347 7.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 281 347 7.0E-06
sp|Q9UK12|ZN222_HUMAN Zinc finger protein 222 OS=Homo sapiens GN=ZNF222 PE=2 SV=2 289 344 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 289 347 7.0E-06
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 289 344 8.0E-06
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 289 344 8.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 284 347 8.0E-06
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 289 347 8.0E-06
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 275 348 8.0E-06
sp|Q9Y467|SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens GN=SALL2 PE=1 SV=4 292 345 8.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 289 347 8.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 344 8.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 289 344 8.0E-06
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 283 345 8.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 294 347 8.0E-06
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 289 347 8.0E-06
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 290 344 8.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 283 347 8.0E-06
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 290 349 8.0E-06
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 287 347 8.0E-06
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 289 344 8.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 289 347 8.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 289 347 8.0E-06
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 289 347 8.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 293 347 8.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 293 347 8.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 289 347 8.0E-06
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 287 347 8.0E-06
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 289 347 8.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 226 347 8.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 289 347 8.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 294 347 8.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 293 347 8.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 289 344 8.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 289 348 8.0E-06
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 297 344 9.0E-06
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 290 347 9.0E-06
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 275 348 9.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 289 344 9.0E-06
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 289 347 9.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 287 347 9.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 283 347 9.0E-06
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 283 345 9.0E-06
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 283 347 9.0E-06
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 285 344 9.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 284 347 9.0E-06
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 289 347 9.0E-06
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 289 358 9.0E-06
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 283 347 9.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 289 347 9.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 293 347 9.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 282 347 9.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 289 347 9.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 294 347 9.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 289 347 9.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 289 344 9.0E-06
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 292 352 9.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 289 347 9.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 281 347 9.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 351 9.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 289 347 9.0E-06
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 289 347 9.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 289 347 9.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 289 347 9.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 281 346 9.0E-06
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 283 345 1.0E-05
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 289 347 1.0E-05
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 293 347 1.0E-05
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 289 347 1.0E-05
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 289 347 1.0E-05
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 283 347 1.0E-05
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 283 344 1.0E-05
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 289 347 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3037
MTMTLPTSQQQRFGPPLNFDYAPHAQPPAFSNPWTSSSPPQPPAAAAASPLYVAGQQQPAVGHAMMAAAKPQQPG
RASSGSASSMASYASLPVATTSAADLLGLSRLHTTSAAYGDPAYAASASPVSGQFAPTSAAPPYDALGYAPAPAR
HSTFAMGSEADRRFSQQQSLQAEADERRSFADALDASHGMLAMSQETPRNIYGSRSNRSSVDSYGFPSTHSTSSS
ISSTGNFSSYYGDSVSDYSTAGSDIESVNSRTLPRPQGLMGAQIPPAPQSMMGQFSSKVSSSTQKKHKCKVCDKR
FTRPSSLQTHMYSHTGEKPFACEVEGCGRHFSVVSNLRRHRKVHRGDARSEAGSEDHHSD*
Coding >Hirsu2|3037
ATGACCATGACGCTACCCACGTCGCAGCAGCAGCGCTTTGGTCCACCCCTGAACTTCGACTATGCCCCCCACGCC
CAGCCGCCAGCCTTTTCGAATCCGTGGACCTCGTCCTCTCCTCCCCAGCCGCCCGCCGCCGCCGCCGCCAGCCCC
CTCTACGTCGCCGGCCAGCAACAGCCCGCCGTCGGCCACGCCATGATGGCCGCCGCCAAGCCTCAGCAGCCGGGC
CGCGCCAGCTCCGGCAGCGCCTCGTCAATGGCATCCTATGCCTCCCTGCCCGTCGCCACCACGTCCGCAGCAGAC
CTCTTGGGCCTGAGCCGCCTGCACACCACGTCCGCCGCCTATGGCGATCCCGCCTACGCCGCCTCGGCCTCGCCC
GTCAGCGGCCAGTTTGCGCCTACGTCCGCCGCGCCCCCCTACGACGCACTGGGCTACGCCCCGGCCCCGGCCCGC
CACTCGACCTTTGCCATGGGCTCCGAGGCGGACAGGCGCTTCTCCCAACAACAGAGCCTACAGGCGGAAGCCGAC
GAACGACGAAGCTTTGCCGACGCTCTCGACGCCAGCCACGGCATGCTCGCCATGAGCCAAGAGACGCCCCGAAAC
ATTTACGGCTCCCGCAGCAACCGGTCGTCGGTCGACTCGTACGGCTTTCCCTCGACGCACTCGACGAGCTCGTCC
ATCTCGTCAACCGGCAACTTCAGCTCCTACTACGGCGACTCCGTCTCGGACTACTCGACGGCGGGATCCGACATC
GAATCCGTCAATTCGAGGACGCTGCCCCGGCCCCAGGGCCTGATGGGCGCCCAGATCCCCCCGGCCCCCCAATCG
ATGATGGGTCAGTTCAGCTCCAAGGTCTCGTCCAGCACGCAGAAGAAGCACAAGTGCAAGGTCTGCGACAAGCGC
TTCACGCGGCCCAGCTCGCTGCAGACGCACATGTATAGTCACACAGGCGAGAAACCGTTTGCTTGCGAGGTGGAG
GGATGCGGTCGTCACTTCTCCGTGGTATCAAACCTGCGACGCCACCGCAAAGTCCACAGAGGCGACGCTCGGTCA
GAAGCTGGATCCGAAGATCACCACTCCGACTAG
Transcript >Hirsu2|3037
ATGACCATGACGCTACCCACGTCGCAGCAGCAGCGCTTTGGTCCACCCCTGAACTTCGACTATGCCCCCCACGCC
CAGCCGCCAGCCTTTTCGAATCCGTGGACCTCGTCCTCTCCTCCCCAGCCGCCCGCCGCCGCCGCCGCCAGCCCC
CTCTACGTCGCCGGCCAGCAACAGCCCGCCGTCGGCCACGCCATGATGGCCGCCGCCAAGCCTCAGCAGCCGGGC
CGCGCCAGCTCCGGCAGCGCCTCGTCAATGGCATCCTATGCCTCCCTGCCCGTCGCCACCACGTCCGCAGCAGAC
CTCTTGGGCCTGAGCCGCCTGCACACCACGTCCGCCGCCTATGGCGATCCCGCCTACGCCGCCTCGGCCTCGCCC
GTCAGCGGCCAGTTTGCGCCTACGTCCGCCGCGCCCCCCTACGACGCACTGGGCTACGCCCCGGCCCCGGCCCGC
CACTCGACCTTTGCCATGGGCTCCGAGGCGGACAGGCGCTTCTCCCAACAACAGAGCCTACAGGCGGAAGCCGAC
GAACGACGAAGCTTTGCCGACGCTCTCGACGCCAGCCACGGCATGCTCGCCATGAGCCAAGAGACGCCCCGAAAC
ATTTACGGCTCCCGCAGCAACCGGTCGTCGGTCGACTCGTACGGCTTTCCCTCGACGCACTCGACGAGCTCGTCC
ATCTCGTCAACCGGCAACTTCAGCTCCTACTACGGCGACTCCGTCTCGGACTACTCGACGGCGGGATCCGACATC
GAATCCGTCAATTCGAGGACGCTGCCCCGGCCCCAGGGCCTGATGGGCGCCCAGATCCCCCCGGCCCCCCAATCG
ATGATGGGTCAGTTCAGCTCCAAGGTCTCGTCCAGCACGCAGAAGAAGCACAAGTGCAAGGTCTGCGACAAGCGC
TTCACGCGGCCCAGCTCGCTGCAGACGCACATGTATAGTCACACAGGCGAGAAACCGTTTGCTTGCGAGGTGGAG
GGATGCGGTCGTCACTTCTCCGTGGTATCAAACCTGCGACGCCACCGCAAAGTCCACAGAGGCGACGCTCGGTCA
GAAGCTGGATCCGAAGATCACCACTCCGACTAG
Gene >Hirsu2|3037
ATGACCATGACGCTACCCACGTCGCAGCAGCAGCGCTTTGGTCCACCCCTGAACTTCGACTATGCCCCCCACGCC
CAGCCGCCAGCCTTTTCGAATCCGTGGACCTCGTCCTCTCCTCCCCAGCCGCCCGCCGCCGCCGCCGCCAGCCCC
CTCTACGTCGCCGGCCAGCAACAGCCCGCCGTCGGCCACGCCATGATGGCCGCCGCCAAGCCTCAGCAGCCGGGC
CGCGCCAGCTCCGGCAGCGCCTCGTCAATGGCATCCTATGCCTCCCTGCCCGTCGCCACCACGTCCGCAGGTGAG
TTCGCGCCCGGCCGCGAGAATGCCGCTCCTCGGCTGACGCCTTCGCCAGCAGACCTCTTGGGCCTGAGCCGCCTG
CACACCACGTCCGCCGCCTATGGCGATCCCGCCTACGCCGCCTCGGCCTCGCCCGTCAGCGGCCAGTTTGCGCCT
ACGTCCGCCGCGCCCCCCTACGACGCACTGGGCTACGCCCCGGCCCCGGCCCGCCACTCGACCTTTGCCATGGGC
TCCGAGGCGGACAGGCGCTTCTCCCAACAACAGTCGGTGCTCCGCGCGCCCATCGGGCCATGCCCGCATTGACCT
CGTCCGCAGGAGCCTACAGGCGGAAGCCGACGAACGACGAAGCTTTGCCGACGCTCTCGACGCCAGCCACGGCAT
GCTCGCCATGAGCCAAGAGACGCCCCGAAACATTTACGGCTCCCGCAGCAACCGGTCGTCGGTCGACTCGTACGG
CTTTCCCTCGACGCACTCGACGAGCTCGTCCATCTCGTCAACCGGCAACTTCAGCTCCTACTACGGCGACTCCGT
CTCGGACTACTCGACGGCGGGATCCGACATCGAATCCGTCAATTCGAGGACGCTGCCCCGGCCCCAGGGCCTGAT
GGGCGCCCAGATCCCCCCGGCCCCCCAATCGATGATGGGTCAGTTCAGCTCCAAGGTCTCGTCCAGCACGCAGAA
GAAGCACAAGTGCAAGGTCTGCGACAAGCGCTTCACGCGGCCCAGCTCGCTGCAGACGCACATGTATAGTCACAC
AGGCGAGAAACGTCAGTTGTTGCCCCCTCACCGCGTTCCAGAGACGTTACGCGTTACTGACTGTTCCCCCCAGCG
TTTGCTTGCGAGGTGGAGGGATGCGGTCGTCACTTCTCCGTGGTATCAAACCTGCGACGCCACCGCAAAGTCCAC
AGAGGCGACGCTCGGTCAGAAGCTGGATCCGAAGATCACCACTCCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail