Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3035
Gene name
LocationContig_1770:2387..4899
Strand+
Gene length (bp)2512
Transcript length (bp)2433
Coding sequence length (bp)2433
Protein length (aa) 811

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13360 PQQ_2 PQQ-like domain 1.3E-12 64 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 427 809 4.0E-19
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 508 764 2.0E-12
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 508 764 2.0E-11
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 508 764 2.0E-11
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 508 764 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 427 809 4.0E-19
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 508 764 2.0E-12
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 508 764 2.0E-11
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 508 764 2.0E-11
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 508 764 5.0E-11
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 344 764 6.0E-11
sp|O13981|EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emc1 PE=3 SV=1 415 765 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3035
MRRSLASGLLLGLSSLAAAVFRDEVGDIDFHYALVGLPQPDTTFFHRPRKEDKASLVYTLSDIGILAAVNPSNGE
LVWRHQLAAGDDGGRDDAAPDRRGFLRAPDGEDWLAAAHGSSVQAWSALTGRNVWRVDFAGEVRDLEILELTESS
RKDVLALFDEDGVTVLRRLHGGLGTVVWEFRENSRDVPLQVSNDIANVYVVSLHGAAGAYNLKVTSLEPATGARV
DHWMVGLKGDIHGPADVAFVGANSAAPIVAWTNQGLTKLSVNVIGSKSKQDFALPPESVSVRVHAPHLAQSQTHF
LAHIRIEEADQALPAHKAIVFHTDLKTSQIKVAYELPAFRGEGTYSTSSEGANVYFVQTTSDQTLIVSSDSHGIL
ARWPNKQALDLHPAHAVTEVVKKAGSQDFAARSAILTKSDDWTMLRNGENDWTRREGLSDAVGAVWAEIPEAEDL
AKVLADEAHTNPLSAYVHRVARHVDDLKYLPAYLAALPERLLGSIAGAEPSSTKQPLLRRDSFGFSKILVVVTRR
GRVYGLDSGNHGRVIWSCNSFPLSMDRPLVLRGLVADDERGTVAMYGAGGWYAVFNASSGVALEVSVDQRRKKSG
VSSTAVVYSESGKDLLPVGPDGLPAGDLPAGWDPEQTVVLRGEGETLRGVRFRAEGGDRVASQEMWRLPMRPGQK
IVQVATPPSHDPIASIGRVLGDRRVLYKYLNPNSVVVAAADETTKTLSVQLVDTVSGQVLASQLHRGVDATKSIS
CTMAENWYTCSFFGDHSVGDGDGDKAGRAVKGYQLVMTDLYESPAPDSRGPLGDAANFSR*
Coding >Hirsu2|3035
ATGCGACGCTCGCTGGCCTCGGGCCTGCTCTTGGGCCTGTCGTCGCTCGCCGCCGCCGTCTTCCGGGACGAGGTC
GGCGACATCGACTTCCACTACGCCCTCGTCGGCCTCCCCCAGCCCGACACCACCTTCTTCCACCGGCCGCGCAAG
GAGGACAAGGCCAGCCTCGTCTACACCCTCAGCGACATCGGCATCCTCGCCGCCGTCAACCCGAGCAACGGCGAG
CTGGTGTGGCGGCATCAGCTGGCGGCCGGCGACGACGGCGGCCGTGACGACGCCGCCCCGGACCGCCGCGGCTTC
CTCCGGGCCCCCGACGGCGAGGACTGGCTGGCGGCCGCGCACGGGTCGAGCGTCCAGGCCTGGAGCGCGCTGACG
GGCCGCAACGTGTGGCGCGTCGACTTCGCCGGCGAGGTCAGGGACCTGGAGATACTCGAGCTGACCGAGTCGTCG
CGCAAGGACGTGCTGGCACTGTTCGACGAGGACGGCGTCACCGTCCTGCGCCGGCTGCACGGCGGCCTCGGCACC
GTCGTCTGGGAGTTCCGCGAGAACAGCAGGGACGTGCCGCTGCAGGTGTCCAACGACATCGCCAACGTCTACGTC
GTCAGCCTGCACGGCGCCGCCGGCGCCTACAACCTCAAGGTCACCTCGCTCGAGCCGGCCACGGGCGCCCGCGTC
GACCACTGGATGGTCGGCCTCAAGGGCGACATCCACGGCCCGGCCGACGTGGCCTTCGTCGGCGCCAACTCGGCC
GCGCCCATCGTCGCCTGGACCAACCAGGGCCTGACCAAGCTCAGCGTCAACGTCATCGGCAGCAAGTCCAAGCAG
GACTTTGCCCTGCCGCCCGAGTCCGTCTCCGTCCGCGTCCACGCGCCCCATCTGGCCCAGTCGCAGACGCACTTC
CTCGCCCACATCCGCATCGAGGAGGCCGACCAGGCTCTGCCGGCCCACAAGGCCATCGTCTTCCACACCGACCTC
AAGACCAGCCAGATCAAGGTGGCCTACGAGCTGCCCGCCTTCCGCGGCGAGGGCACCTACTCCACCAGCTCCGAG
GGCGCCAACGTCTACTTCGTCCAGACCACCAGCGACCAGACGCTCATCGTCTCGTCCGACTCGCACGGCATCCTC
GCCCGCTGGCCGAACAAGCAGGCCCTCGACCTCCACCCCGCCCACGCCGTGACCGAGGTCGTCAAGAAGGCCGGC
AGCCAAGACTTTGCCGCCCGCTCCGCCATCCTCACCAAGTCGGACGACTGGACCATGCTCCGCAACGGCGAGAAC
GACTGGACCCGCCGCGAGGGCCTCTCCGACGCCGTCGGCGCCGTCTGGGCCGAGATACCCGAGGCCGAGGACCTG
GCCAAGGTGCTGGCCGACGAGGCGCACACGAACCCGCTGTCGGCCTACGTCCACCGCGTCGCCCGCCACGTCGAC
GACCTGAAATACCTCCCGGCCTACCTGGCCGCCCTCCCCGAGCGCCTGCTGGGCAGCATCGCCGGCGCCGAGCCG
TCGTCGACCAAGCAGCCGCTCCTCCGCCGAGACAGCTTCGGCTTCAGCAAAATCCTCGTCGTCGTCACCCGCCGG
GGGCGCGTCTACGGCCTCGACAGCGGGAACCACGGCCGCGTCATCTGGTCTTGCAACTCGTTCCCCCTCAGCATG
GACAGGCCGCTGGTCCTCAGGGGGCTCGTCGCCGACGACGAGCGGGGGACCGTCGCCATGTACGGCGCCGGGGGG
TGGTACGCCGTCTTCAACGCGAGCTCGGGCGTGGCCCTCGAGGTGTCGGTCGACCAGCGCCGCAAGAAGTCGGGC
GTGTCCTCCACGGCCGTCGTCTACAGCGAGTCGGGCAAGGACCTGCTCCCCGTCGGACCCGACGGCCTGCCGGCG
GGCGACCTCCCCGCCGGCTGGGACCCGGAGCAGACGGTCGTCCTCCGCGGCGAGGGCGAGACGCTCCGGGGCGTC
AGGTTCCGTGCCGAGGGCGGTGACCGGGTGGCCAGCCAGGAGATGTGGCGGCTGCCGATGAGGCCCGGGCAGAAG
ATTGTGCAGGTGGCGACGCCGCCCTCGCACGACCCCATCGCCTCGATCGGGCGCGTCCTCGGGGACCGCCGCGTG
CTGTACAAGTACCTCAACCCCAACAGCGTCGTGGTGGCGGCGGCGGACGAGACGACCAAGACGCTGTCGGTCCAG
CTCGTGGACACGGTCTCTGGCCAGGTGCTGGCGTCGCAGCTGCACCGGGGCGTGGACGCGACCAAGTCCATCTCG
TGCACCATGGCCGAGAACTGGTACACGTGCTCCTTCTTCGGCGACCACAGCGTCGGCGACGGCGACGGCGACAAG
GCGGGCCGGGCCGTCAAGGGCTACCAGCTGGTGATGACGGACCTGTACGAGTCGCCGGCGCCCGACAGCCGCGGG
CCGCTGGGCGACGCGGCCAACTTCTCCCGCTGA
Transcript >Hirsu2|3035
ATGCGACGCTCGCTGGCCTCGGGCCTGCTCTTGGGCCTGTCGTCGCTCGCCGCCGCCGTCTTCCGGGACGAGGTC
GGCGACATCGACTTCCACTACGCCCTCGTCGGCCTCCCCCAGCCCGACACCACCTTCTTCCACCGGCCGCGCAAG
GAGGACAAGGCCAGCCTCGTCTACACCCTCAGCGACATCGGCATCCTCGCCGCCGTCAACCCGAGCAACGGCGAG
CTGGTGTGGCGGCATCAGCTGGCGGCCGGCGACGACGGCGGCCGTGACGACGCCGCCCCGGACCGCCGCGGCTTC
CTCCGGGCCCCCGACGGCGAGGACTGGCTGGCGGCCGCGCACGGGTCGAGCGTCCAGGCCTGGAGCGCGCTGACG
GGCCGCAACGTGTGGCGCGTCGACTTCGCCGGCGAGGTCAGGGACCTGGAGATACTCGAGCTGACCGAGTCGTCG
CGCAAGGACGTGCTGGCACTGTTCGACGAGGACGGCGTCACCGTCCTGCGCCGGCTGCACGGCGGCCTCGGCACC
GTCGTCTGGGAGTTCCGCGAGAACAGCAGGGACGTGCCGCTGCAGGTGTCCAACGACATCGCCAACGTCTACGTC
GTCAGCCTGCACGGCGCCGCCGGCGCCTACAACCTCAAGGTCACCTCGCTCGAGCCGGCCACGGGCGCCCGCGTC
GACCACTGGATGGTCGGCCTCAAGGGCGACATCCACGGCCCGGCCGACGTGGCCTTCGTCGGCGCCAACTCGGCC
GCGCCCATCGTCGCCTGGACCAACCAGGGCCTGACCAAGCTCAGCGTCAACGTCATCGGCAGCAAGTCCAAGCAG
GACTTTGCCCTGCCGCCCGAGTCCGTCTCCGTCCGCGTCCACGCGCCCCATCTGGCCCAGTCGCAGACGCACTTC
CTCGCCCACATCCGCATCGAGGAGGCCGACCAGGCTCTGCCGGCCCACAAGGCCATCGTCTTCCACACCGACCTC
AAGACCAGCCAGATCAAGGTGGCCTACGAGCTGCCCGCCTTCCGCGGCGAGGGCACCTACTCCACCAGCTCCGAG
GGCGCCAACGTCTACTTCGTCCAGACCACCAGCGACCAGACGCTCATCGTCTCGTCCGACTCGCACGGCATCCTC
GCCCGCTGGCCGAACAAGCAGGCCCTCGACCTCCACCCCGCCCACGCCGTGACCGAGGTCGTCAAGAAGGCCGGC
AGCCAAGACTTTGCCGCCCGCTCCGCCATCCTCACCAAGTCGGACGACTGGACCATGCTCCGCAACGGCGAGAAC
GACTGGACCCGCCGCGAGGGCCTCTCCGACGCCGTCGGCGCCGTCTGGGCCGAGATACCCGAGGCCGAGGACCTG
GCCAAGGTGCTGGCCGACGAGGCGCACACGAACCCGCTGTCGGCCTACGTCCACCGCGTCGCCCGCCACGTCGAC
GACCTGAAATACCTCCCGGCCTACCTGGCCGCCCTCCCCGAGCGCCTGCTGGGCAGCATCGCCGGCGCCGAGCCG
TCGTCGACCAAGCAGCCGCTCCTCCGCCGAGACAGCTTCGGCTTCAGCAAAATCCTCGTCGTCGTCACCCGCCGG
GGGCGCGTCTACGGCCTCGACAGCGGGAACCACGGCCGCGTCATCTGGTCTTGCAACTCGTTCCCCCTCAGCATG
GACAGGCCGCTGGTCCTCAGGGGGCTCGTCGCCGACGACGAGCGGGGGACCGTCGCCATGTACGGCGCCGGGGGG
TGGTACGCCGTCTTCAACGCGAGCTCGGGCGTGGCCCTCGAGGTGTCGGTCGACCAGCGCCGCAAGAAGTCGGGC
GTGTCCTCCACGGCCGTCGTCTACAGCGAGTCGGGCAAGGACCTGCTCCCCGTCGGACCCGACGGCCTGCCGGCG
GGCGACCTCCCCGCCGGCTGGGACCCGGAGCAGACGGTCGTCCTCCGCGGCGAGGGCGAGACGCTCCGGGGCGTC
AGGTTCCGTGCCGAGGGCGGTGACCGGGTGGCCAGCCAGGAGATGTGGCGGCTGCCGATGAGGCCCGGGCAGAAG
ATTGTGCAGGTGGCGACGCCGCCCTCGCACGACCCCATCGCCTCGATCGGGCGCGTCCTCGGGGACCGCCGCGTG
CTGTACAAGTACCTCAACCCCAACAGCGTCGTGGTGGCGGCGGCGGACGAGACGACCAAGACGCTGTCGGTCCAG
CTCGTGGACACGGTCTCTGGCCAGGTGCTGGCGTCGCAGCTGCACCGGGGCGTGGACGCGACCAAGTCCATCTCG
TGCACCATGGCCGAGAACTGGTACACGTGCTCCTTCTTCGGCGACCACAGCGTCGGCGACGGCGACGGCGACAAG
GCGGGCCGGGCCGTCAAGGGCTACCAGCTGGTGATGACGGACCTGTACGAGTCGCCGGCGCCCGACAGCCGCGGG
CCGCTGGGCGACGCGGCCAACTTCTCCCGCTGA
Gene >Hirsu2|3035
ATGCGACGCTCGCTGGCCTCGGGCCTGCTCTTGGGCCTGTCGTCGCTCGCCGCCGCCGTCTTCCGGGACGAGGTC
GGCGACATCGACTTCCACTACGCCCTCGTCGGCCTCCCCCAGCCCGACACCACCTTCTTCCACCGGCCGCGCAAG
GAGGACAAGGCCAGCCTCGTCTACACCCTCAGCGACATCGGCATCCTCGCCGCCGTCAACCCGAGCAACGGCGAG
CTGGTGTGGCGGCATCAGCTGGCGGCCGGCGACGACGGCGGCCGTGACGACGCCGCCCCGGACCGCCGCGGCTTC
CTCCGGGCCCCCGACGGCGAGGACTGGCTGGCGGCCGCGCACGGGTCGAGCGTCCAGGCCTGGAGCGCGCTGACG
GGCCGCAACGTGTGGCGCGTCGACTTCGCCGGCGAGGTCAGGGACCTGGAGATACTCGAGCTGACCGAGTCGTCG
CGCAAGGACGTGCTGGCACTGTTCGACGAGGACGGCGTCACCGTCCTGCGCCGGCTGCACGGCGGCCTCGGCACC
GTCGTCTGGGAGTTCCGCGAGAACAGCAGGGACGTGCCGCTGCAGGTGTCCAACGACATCGCCAACGTCTACGTC
GTCAGCCTGCACGGCGCCGCCGGCGCCTACAACCTCAAGGTCACCTCGCTCGAGCCGGCCACGGGCGCCCGCGTC
GACCACTGGATGGTCGGCCTCAAGGGCGACATCCACGGCCCGGCCGACGTGGCCTTCGTCGGCGCCAACTCGGCC
GCGCCCATCGTCGCCTGGACCAACCAGGGCCTGACCAAGCTCAGCGTCAACGTCATCGGCAGCAAGTCCAAGCAG
GACTTTGCCCTGCCGCCCGAGTCCGTCTCCGTCCGCGTCCACGCGCCCCATCTGGCCCAGTCGCAGACGCACTTC
CTCGCCCACATCCGCATCGAGGAGGCCGACCAGGCTCTGCCGGCCCACAAGGCCATCGTCTTCCACACCGACCTC
AAGACCAGCCAGATCAAGGTGGCCTACGAGCTGCCCGCCTTCCGCGGCGAGGGCACCTACTCCACCAGCTCCGAG
GGCGCCAACGTCTACTTCGTCCAGACCACCAGCGACCAGACGCTCATCGTCTCGTCCGACTCGCACGGCATCCTC
GCCCGCTGGCCGAACAAGCAGGCCCTCGACCTCCACCCCGCCCACGCCGTGACCGAGGTCGTCAAGAAGGCCGGC
AGCCAAGACTTTGCCGCCCGCTCCGCCATCCTCACCAAGTCGGACGACTGGACCATGCTCCGCAACGGCGAGAAC
GACTGGACCCGCCGCGAGGGCCTCTCCGACGCCGTCGGCGCCGTCTGGGCCGAGATACCCGAGGCCGAGGACCTG
GCCAAGGTGCTGGCCGACGAGGCGCACACGAACCCGCTGTCGGCCTACGTCCACCGCGTCGCCCGCCACGTCGAC
GACCTGAAATACCTCCCGGCCTACCTGGCCGCCCTCCCCGAGCGCCTGCTGGGCAGCATCGCCGGCGCCGAGCCG
TCGTCGACCAAGCAGCCGCTCCTCCGCCGAGACAGCTTCGGCTTCAGCAAAATCCTCGTCGTCGTCACCCGCCGG
GGGCGCGTCTACGGCCTCGACAGCGGGAACCACGGCCGCGTCATCTGGTCTTGCAACTCGTTCCCCCTCAGCATG
GACAGGCCGCTGGTCCTCAGGGGGCTCGTCGCCGACGACGAGCGGGGGACCGTCGCCATGTACGGCGCCGGGGGG
TGGTACGCCGTCTTCAACGCGAGCTCGGGCGTGGCCCTCGAGGTGTCGGTCGACCAGCGCCGCAAGAAGTCGGGC
GTGTCCTCCACGGCCGTCGTCTACAGCGAGTCGGGCAAGGACCTGCTCCCCGTCGGACCCGACGGCCTGCCGGCG
GGCGACCTCCCCGCCGGCTGGGACCCGGAGCAGACGGTCGTCCTCCGCGGCGAGGGCGAGACGCTCCGGGGCGTC
AGGTTCCGTGCCGAGGGCGGTGACCGGGTGGCCAGCCAGGAGATGTGGCGGCTGCCGATGAGGCCCGGGCAGAAG
ATTGTGCAGGTGGCGACGCCGCCCTCGCACGACCCCATCGCCTCGATCGGGCGCGTCCTCGGGGACCGCCGCGTG
CTGTACAAGTACCTCAACCCCAACAGCGTCGTGGTGGCGGCGGCGGACGAGACGACCAAGACGCTGTCGGTCCAG
CTCGTGGACACGGTCTCTGGCCAGGTGCTGGCGTCGCAGCTGCACCGGGGCGTGGACGCGACCAAGTCCATCTCG
TGCACCATGGCCGAGAACTGGTACACGTGCTCCTTCTTCGGCGACCACAGCGTCGGCGACGGCGACGGCGACAAG
GCGGGCCGGGCCGTCAAGGGCTACCAGCTGGTGATGACGGACCTGTACGAGTCGCCGGCGCCCGACAGCCGCGGG
CCGCTGGGCGACGCGGCCAACTTCTCGTCGCTGGCGCCGATCGAGGACGCGACGGGCGGGGTGCCGCTGCCGTGG
GCCGTGTCGCAGGCCTTCGTCGTGTCGCAGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail