Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|303
Gene name
LocationContig_1058:3367..4788
Strand-
Gene length (bp)1421
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05007 Mannosyl_trans Mannosyltransferase (PIG-M) 9.4E-80 139 400
PF06728 PIG-U GPI transamidase subunit PIG-U 3.5E-09 60 252
PF09594 GT87 Glycosyltransferase family 87 1.5E-05 70 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 9 420 0.0E+00
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 6 405 4.0E-158
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 8 406 4.0E-157
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 17 403 2.0E-149
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 8 403 3.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 9 420 0.0E+00
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 6 405 4.0E-158
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 8 406 4.0E-157
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 17 403 2.0E-149
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 8 403 3.0E-149
sp|Q9P6R5|GPI14_SCHPO GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi14 PE=3 SV=2 22 401 7.0E-118
sp|Q6BHI9|GPI14_DEBHA GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI14 PE=3 SV=2 8 403 3.0E-112
sp|Q5AMR5|GPI14_CANAL GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI14 PE=3 SV=1 15 395 3.0E-108
sp|Q6FXQ5|GPI14_CANGA GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI14 PE=3 SV=1 19 416 3.0E-99
sp|Q6CRE7|GPI14_KLULA GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI14 PE=3 SV=1 23 419 2.0E-96
sp|Q75C82|GPI14_ASHGO GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI14 PE=3 SV=1 11 407 6.0E-93
sp|P47088|GPI14_YEAST GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI14 PE=1 SV=2 14 418 3.0E-86
sp|Q66IJ4|PIGM_XENTR GPI mannosyltransferase 1 OS=Xenopus tropicalis GN=pigm PE=2 SV=1 7 403 4.0E-80
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 14 397 3.0E-79
sp|Q5EA10|PIGM_BOVIN GPI mannosyltransferase 1 OS=Bos taurus GN=PIGM PE=2 SV=1 12 416 1.0E-78
sp|Q5RAH7|PIGM_PONAB GPI mannosyltransferase 1 OS=Pongo abelii GN=PIGM PE=2 SV=1 12 402 3.0E-77
sp|Q9H3S5|PIGM_HUMAN GPI mannosyltransferase 1 OS=Homo sapiens GN=PIGM PE=1 SV=1 12 402 3.0E-77
sp|Q8C2R7|PIGM_MOUSE GPI mannosyltransferase 1 OS=Mus musculus GN=Pigm PE=2 SV=2 12 402 9.0E-77
sp|Q4R4E1|PIGM_MACFA GPI mannosyltransferase 1 OS=Macaca fascicularis GN=PIGM PE=2 SV=1 8 402 1.0E-76
sp|Q9EQY6|PIGM_RAT GPI mannosyltransferase 1 OS=Rattus norvegicus GN=Pigm PE=2 SV=1 12 402 2.0E-76
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 10 402 1.0E-72
sp|Q5F380|PIGM_CHICK GPI mannosyltransferase 1 OS=Gallus gallus GN=PIGM PE=2 SV=2 17 403 3.0E-67
sp|Q7T310|PIGM_DANRE GPI mannosyltransferase 1 OS=Danio rerio GN=pigm PE=2 SV=1 30 401 4.0E-62
sp|Q9BPQ5|PIGM_TRYB2 GPI mannosyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIGM PE=2 SV=2 27 391 2.0E-52
[Show less]

GO

GO Term Description Terminal node
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0016021 integral component of membrane Yes
GO:0042765 GPI-anchor transamidase complex Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0044446 intracellular organelle part No
GO:0006644 phospholipid metabolic process No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:1903509 liposaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0044432 endoplasmic reticulum part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0044425 membrane part No
GO:0006664 glycolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0006497 protein lipidation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 75 97 22
3 138 160 22
4 167 189 22
5 216 238 22
6 276 298 22
7 313 335 22
8 342 364 22
9 379 401 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|303
MAARPAPLLLRPAALFVGAALLRLGLLGYGAWQDGRSAVKYTDVDYLVFTDAARFVARGHAAGPYARETYRYTPL
LAWLLLPTTACFGLGKLLFAAADLLAGWLLLRLLRRRRAKGAGGGGADEAFAALWLWNPMVAAISTRGSSEGLLG
VLTVALLWAVETRRVAAAGAVLGLAVHVKIYPFIYAPAIVWWMDDARMGRPAAGPALVRFFSPDRIRLALVSLAT
FAGLNLLMYSIYGSPFVVHTYLHHVTRVDHRHNFSPYHVLLYLNSAAPSALRVESLAFVPQLLLSCLLIPLVLAK
RDLATSMMAQTFAFVTFNKVCTSQYFLWYMVFLPLYLPSSSLLRRPALGLSALGLWVAGQAAWLHQAYRLEFLGA
STFFPGLWLAELAFFLVNCWVLGLIVADGARRAGPGPDAPKAHLE*
Coding >Hirsu2|303
ATGGCCGCCCGTCCGGCCCCGCTCCTCCTCCGGCCGGCGGCGCTGTTCGTCGGCGCGGCGCTGCTGCGGCTCGGC
CTGCTGGGCTACGGCGCGTGGCAGGACGGCCGGTCGGCGGTCAAGTACACCGACGTCGACTACCTGGTCTTCACG
GACGCGGCGCGCTTCGTCGCGCGCGGGCACGCGGCCGGGCCCTACGCCCGCGAAACGTACCGCTACACGCCGCTG
CTGGCCTGGCTGCTGCTGCCGACGACGGCCTGCTTCGGCCTCGGCAAGCTGCTCTTCGCCGCCGCCGACCTGCTC
GCCGGCTGGCTGCTGCTGCGCCTCCTGCGCCGCCGCCGGGCGAAGGGCGCTGGCGGTGGCGGTGCGGACGAGGCC
TTCGCCGCCCTTTGGCTCTGGAACCCGATGGTGGCCGCCATCAGCACCCGCGGCAGCTCCGAGGGCCTGCTCGGC
GTCCTGACCGTCGCCCTGCTGTGGGCCGTCGAGACGCGCCGGGTGGCGGCCGCCGGCGCCGTCCTCGGCCTCGCC
GTCCACGTCAAGATCTACCCCTTCATCTACGCGCCCGCCATAGTCTGGTGGATGGACGACGCGCGCATGGGCCGC
CCGGCCGCCGGCCCCGCCCTCGTCCGCTTCTTCTCGCCCGACAGGATCCGGCTGGCGCTCGTCAGCCTGGCGACC
TTTGCCGGCCTCAACCTGCTCATGTACTCCATCTACGGCTCGCCCTTCGTCGTCCACACCTACCTCCACCACGTC
ACCCGCGTCGACCACCGCCACAACTTCTCGCCCTACCACGTCCTCCTCTACCTTAACTCGGCCGCGCCCTCGGCT
CTGCGCGTCGAATCGCTCGCCTTCGTCCCGCAGCTGCTCCTCTCCTGCCTGCTCATCCCGCTCGTGCTCGCCAAG
CGGGACCTCGCCACGTCCATGATGGCCCAGACCTTTGCCTTTGTCACCTTCAACAAGGTCTGCACCTCCCAGTAT
TTCCTCTGGTACATGGTCTTCCTCCCCCTCTACCTGCCCTCCTCTTCCCTCCTCCGCCGTCCCGCCCTCGGCCTC
TCTGCCCTTGGTCTCTGGGTCGCCGGCCAGGCCGCCTGGCTGCACCAGGCCTACCGCCTCGAGTTCCTCGGCGCC
AGCACCTTCTTCCCGGGCCTGTGGCTGGCCGAGCTCGCCTTCTTCCTCGTCAACTGCTGGGTCCTGGGCCTCATC
GTCGCCGACGGCGCCCGCCGCGCCGGCCCCGGCCCCGACGCCCCGAAGGCCCATCTCGAGTAG
Transcript >Hirsu2|303
ATGGCCGCCCGTCCGGCCCCGCTCCTCCTCCGGCCGGCGGCGCTGTTCGTCGGCGCGGCGCTGCTGCGGCTCGGC
CTGCTGGGCTACGGCGCGTGGCAGGACGGCCGGTCGGCGGTCAAGTACACCGACGTCGACTACCTGGTCTTCACG
GACGCGGCGCGCTTCGTCGCGCGCGGGCACGCGGCCGGGCCCTACGCCCGCGAAACGTACCGCTACACGCCGCTG
CTGGCCTGGCTGCTGCTGCCGACGACGGCCTGCTTCGGCCTCGGCAAGCTGCTCTTCGCCGCCGCCGACCTGCTC
GCCGGCTGGCTGCTGCTGCGCCTCCTGCGCCGCCGCCGGGCGAAGGGCGCTGGCGGTGGCGGTGCGGACGAGGCC
TTCGCCGCCCTTTGGCTCTGGAACCCGATGGTGGCCGCCATCAGCACCCGCGGCAGCTCCGAGGGCCTGCTCGGC
GTCCTGACCGTCGCCCTGCTGTGGGCCGTCGAGACGCGCCGGGTGGCGGCCGCCGGCGCCGTCCTCGGCCTCGCC
GTCCACGTCAAGATCTACCCCTTCATCTACGCGCCCGCCATAGTCTGGTGGATGGACGACGCGCGCATGGGCCGC
CCGGCCGCCGGCCCCGCCCTCGTCCGCTTCTTCTCGCCCGACAGGATCCGGCTGGCGCTCGTCAGCCTGGCGACC
TTTGCCGGCCTCAACCTGCTCATGTACTCCATCTACGGCTCGCCCTTCGTCGTCCACACCTACCTCCACCACGTC
ACCCGCGTCGACCACCGCCACAACTTCTCGCCCTACCACGTCCTCCTCTACCTTAACTCGGCCGCGCCCTCGGCT
CTGCGCGTCGAATCGCTCGCCTTCGTCCCGCAGCTGCTCCTCTCCTGCCTGCTCATCCCGCTCGTGCTCGCCAAG
CGGGACCTCGCCACGTCCATGATGGCCCAGACCTTTGCCTTTGTCACCTTCAACAAGGTCTGCACCTCCCAGTAT
TTCCTCTGGTACATGGTCTTCCTCCCCCTCTACCTGCCCTCCTCTTCCCTCCTCCGCCGTCCCGCCCTCGGCCTC
TCTGCCCTTGGTCTCTGGGTCGCCGGCCAGGCCGCCTGGCTGCACCAGGCCTACCGCCTCGAGTTCCTCGGCGCC
AGCACCTTCTTCCCGGGCCTGTGGCTGGCCGAGCTCGCCTTCTTCCTCGTCAACTGCTGGGTCCTGGGCCTCATC
GTCGCCGACGGCGCCCGCCGCGCCGGCCCCGGCCCCGACGCCCCGAAGGCCCATCTCGAGTAG
Gene >Hirsu2|303
ATGGCCGCCCGTCCGGCCCCGCTCCTCCTCCGGCCGGCGGCGCTGTTCGTCGGCGCGGCGCTGCTGCGGCTCGGC
CTGCTGGGCTACGGCGCGTGGCAGGACGGCCGGTCGGCGGTCAAGTACACCGACGTCGACTACCTGGTCTTCACG
GACGCGGCGCGCTTCGTCGCGCGCGGGCACGCGGCCGGGCCCTACGCCCGCGAAACGTACCGCTACACGCCGCTG
CTGGCCTGGCTGCTGCTGCCGACGACGGCCTGCTTCGGCCTCGGCAAGCTGCTCTTCGCCGCCGCCGACCTGCTC
GCCGGCTGGCTGCTGCTGCGCCTCCTGCGCCGCCGCCGGGCGAAGGGCGCTGGCGGTGGCGGTGCGGACGAGGCC
TTCGCCGCCCTTTGGCTCTGGAACCCGATGGTGGCCGCCATCAGCACCCGCGGCAGCTCCGAGGGCCTGCTCGGC
GTCCTGACCGTCGCCCTGCTGTGGGCCGTCGAGACGCGCCGGGTGGCGGCCGCCGGCGCCGTCCTCGGCCTCGCC
GTCCACGTCAAGATCTACCCCTTCATCTACGCGCCCGCCATAGTCTGGTGGATGGACGACGCGCGCATGGGCCGC
CCGGCCGCCGGCCCCGCCCTCGTCCGCTTCTTCTCGCCCGACAGGATCCGGCTGGCGCTCGTCAGCCTGGCGACC
TTTGCCGGCCTCAACCTGCTCATGTACTCCATGTTCGTCCGCCAGAGCAACCGCCTCTTTCCCCCTCTCGTTCGG
GTTTTCCCCCTAAAACGTCTCTCGCAGCTACGGCTCGCCCTTCGTCGTCCACACCTACCTCCACCACGTCACCCG
CGTCGACCACCGCCACAACTTCTCGCCCTACCACGTCCTCCTCTACCTTAACTCGGCCGCGCCCTCGGCTCTGCG
CGTCGAATCGCTCGCCTTCGTCCCGCAGCTGCTCCTCTCCTGCCTGCTCATCCCGCTCGTGCTCGCCAAGCGGGA
CCTCGCCACGTCCATGATGGCCCAGACCTTTGCCTTTGTCACCTTCAACAAGGTCTGCACCTCCCAGGTAAGCAC
AGAAAAAAGAAGAAGAAAGAAATCCTCGTTGCAAACCCCCATCTCTTCGAGCTTTCCTCTTGCTGAATCTTCCCG
GGTAGTATTTCCTCTGGTACATGGTCTTCCTCCCCCTCTACCTGCCCTCCTCTTCCCTCCTCCGCCGTCCCGCCC
TCGGCCTCTCTGCCCTTGGTCTCTGGGTCGCCGGCCAGGCCGCCTGGCTGCACCAGGCCTACCGCCTCGAGTTCC
TCGGCGCCAGCACCTTCTTCCCGGGCCTGTGGCTGGCCGAGCTCGCCTTCTTCCTCGTCAACTGCTGGGTCCTGG
GCCTCATCGTCGCCGACGGCGCCCGCCGCGCCGGCCCCGGCCCCGACGCCCCGAAGGCCCATCTCGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail