Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3029
Gene name
LocationContig_177:16107..16992
Strand+
Gene length (bp)885
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.5E-11 47 222
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-07 53 154
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.3E-04 44 81

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3029
MSTSFEPIPSSLAAQIAASNYTLSPEHLSVEVGQAEHRIQLVNQWRIPASSRILEIGCGQGTCTAVLAAAVGADG
HVDAVDPSPPDYGAPVTLGQAQSHLSAGPFGSRITWHRAETTSFLADHPHERWDYAVLAHSIWYFDSPEELSEIL
PALKDRCGTLVVAEYALTATHAHALPHVLTAIAQGLLHREMQKPATEANIRCLLSPDGIKGAAQDAGWRLESESV
VVPGDALLDGSWDTSMVQSRGFEEEVENIHDSTAKALLRSSRDAVAGAVKSLGGNKPRTMDVWVARFAS*
Coding >Hirsu2|3029
ATGTCGACCTCGTTTGAGCCCATTCCCTCCTCTCTTGCCGCCCAAATCGCTGCCAGCAACTACACCTTGAGCCCG
GAGCACCTATCAGTCGAAGTCGGACAGGCGGAGCACAGGATCCAGCTCGTCAACCAGTGGCGCATCCCCGCCAGC
AGTAGGATCCTAGAAATCGGCTGCGGGCAGGGCACTTGCACGGCGGTGCTGGCGGCAGCCGTTGGGGCCGATGGC
CACGTCGACGCCGTAGACCCGAGCCCTCCGGACTACGGCGCCCCCGTCACCCTCGGCCAGGCGCAGTCGCACCTC
TCGGCCGGGCCCTTCGGGTCCCGTATCACCTGGCATCGCGCCGAGACGACCAGCTTCTTAGCTGACCATCCGCAT
GAGAGGTGGGACTACGCCGTCCTAGCACACTCCATCTGGTACTTCGACTCGCCCGAGGAGCTGTCTGAGATCCTG
CCGGCGCTCAAGGACCGCTGTGGCACGCTCGTCGTGGCCGAGTATGCCCTGACGGCGACGCATGCGCACGCCTTG
CCGCACGTCTTGACCGCCATAGCACAAGGCCTGCTGCATCGCGAGATGCAGAAGCCGGCGACCGAGGCCAACATT
CGTTGTCTCCTTAGCCCCGACGGCATCAAGGGCGCCGCGCAGGACGCGGGCTGGCGCCTCGAGAGCGAGTCTGTT
GTCGTTCCAGGCGATGCCTTGTTGGATGGAAGCTGGGATACGTCCATGGTGCAGAGCAGGGGATTCGAAGAGGAG
GTTGAGAATATTCACGACTCCACAGCCAAGGCGCTCCTAAGGTCGTCTCGGGACGCCGTTGCAGGAGCTGTTAAG
TCCCTGGGAGGGAACAAGCCGAGAACCATGGACGTTTGGGTTGCACGGTTCGCGTCTTAG
Transcript >Hirsu2|3029
ATGTCGACCTCGTTTGAGCCCATTCCCTCCTCTCTTGCCGCCCAAATCGCTGCCAGCAACTACACCTTGAGCCCG
GAGCACCTATCAGTCGAAGTCGGACAGGCGGAGCACAGGATCCAGCTCGTCAACCAGTGGCGCATCCCCGCCAGC
AGTAGGATCCTAGAAATCGGCTGCGGGCAGGGCACTTGCACGGCGGTGCTGGCGGCAGCCGTTGGGGCCGATGGC
CACGTCGACGCCGTAGACCCGAGCCCTCCGGACTACGGCGCCCCCGTCACCCTCGGCCAGGCGCAGTCGCACCTC
TCGGCCGGGCCCTTCGGGTCCCGTATCACCTGGCATCGCGCCGAGACGACCAGCTTCTTAGCTGACCATCCGCAT
GAGAGGTGGGACTACGCCGTCCTAGCACACTCCATCTGGTACTTCGACTCGCCCGAGGAGCTGTCTGAGATCCTG
CCGGCGCTCAAGGACCGCTGTGGCACGCTCGTCGTGGCCGAGTATGCCCTGACGGCGACGCATGCGCACGCCTTG
CCGCACGTCTTGACCGCCATAGCACAAGGCCTGCTGCATCGCGAGATGCAGAAGCCGGCGACCGAGGCCAACATT
CGTTGTCTCCTTAGCCCCGACGGCATCAAGGGCGCCGCGCAGGACGCGGGCTGGCGCCTCGAGAGCGAGTCTGTT
GTCGTTCCAGGCGATGCCTTGTTGGATGGAAGCTGGGATACGTCCATGGTGCAGAGCAGGGGATTCGAAGAGGAG
GTTGAGAATATTCACGACTCCACAGCCAAGGCGCTCCTAAGGTCGTCTCGGGACGCCGTTGCAGGAGCTGTTAAG
TCCCTGGGAGGGAACAAGCCGAGAACCATGGACGTTTGGGTTGCACGGTTCGCGTCTTAG
Gene >Hirsu2|3029
ATGTCGACCTCGTTTGAGCCCATTCCCTCCTCTCTTGCCGCCCAAATCGCTGCCAGCAACTACACCTTGAGCCCG
GAGCACCTATCAGTCGAAGTCGGACAGGCGGAGCACAGGATCCAGCTCGTCAACCAGTGGCGCATCCCCGCCAGC
AGTAGGATCCTAGAAATCGGCTGCGGGCAGGGCACTTGCACGGCGGTGCTGGCGGCAGCCGTTGGGGCCGATGGC
CACGTCGACGCCGTAGACCCGAGCCCTCCGGACTACGGCGCCCCCGTCACCCTCGGCCAGGCGCAGTCGCACCTC
TCGGCCGGGCCCTTCGGGTCCCGTATCACCTGGCATCGCGCCGAGACGACCAGCTTCTTAGCTGACCATCCGCAT
GAGAGGTGGGACTACGCCGTCCTAGCACACTCCATCTGGTACTTCGACTCGCCCGAGGAGCTGTCTGAGATCCTG
CCGGCGCTCAAGGACCGCTGTGGCACGCTCGTCGTGGCCGAGTATGCCCTGACGGCGACGCATGCGCACGCCTTG
CCGCACGTCTTGACCGCCATAGCACAAGGCCTGCTGCATCGCGAGATGCAGAAGCCGGCGACCGAGGCCAACATT
CGTTGTCTCCTTAGCCCCGACGGCATCAAGGGCGCCGCGCAGGACGCGGGCTGGCGCCTCGAGAGCGAGTCTGTT
GTCGTTCCAGGCGATGCCTTGTTGGATGGAAGCTGGGATACGTCCATGGTGCAGAGCAGGGGATTCGAAGAGGAG
GTTGAGAATATTCACGACTCCACAGCCAAGGCGCTCCTAAGGTCGTCTCGGGACGCCGTTGCAGGAGCTGTTAAG
TCCCTGGGAGGGAACAAGCCGAGAACCATGGACGTTTGGGTTGCACGGTTCGCGTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail