Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3027
Gene name
LocationContig_177:11158..11701
Strand-
Gene length (bp)543
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0938 0.0364 0.9186 0.0837 0.1037 0.0283 0.1344 0.1407 0.0744 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2289
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|7716
Ophiocordyceps australis map64 (Brazil) OphauB2|7717
Ophiocordyceps subramaniannii Hirsu2|3027 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8283

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3027
MLGPSILLFAAGASAILNGLVSQVVVDDDPAKDKYVCPLNCIFRIGYFMDNGISCGSNKVVVLESFERPPIRTLF
HVCNGSTPESQLDRWRERELRDGEEPPLCDVGKAEDPYAPTICMSFKFGNSTEPGVIRNYTDLRPQLEADFFGVA
GRTPPPAAEQASAGCDGSTGPENEECWTWN*
Coding >Hirsu2|3027
ATGCTCGGCCCATCCATACTGCTTTTCGCTGCTGGGGCCAGTGCGATCCTCAACGGCTTGGTCTCACAAGTTGTG
GTCGACGACGACCCTGCGAAGGACAAATACGTCTGTCCCTTGAACTGTATCTTTCGCATCGGCTACTTTATGGAC
AACGGTATCTCTTGCGGTAGCAACAAGGTCGTCGTTCTGGAGTCGTTCGAGCGACCCCCAATCCGCACCCTTTTC
CACGTCTGTAATGGATCGACACCCGAGTCGCAACTCGACCGCTGGCGAGAGCGCGAGCTCCGGGACGGAGAAGAG
CCCCCGCTGTGCGACGTAGGGAAAGCAGAGGACCCGTACGCACCCACAATCTGCATGTCTTTCAAATTTGGGAAT
AGCACAGAACCAGGAGTTATAAGAAATTACACCGATTTGCGCCCACAGCTCGAAGCCGATTTCTTCGGTGTGGCT
GGTCGAACACCCCCGCCAGCCGCTGAACAAGCCTCCGCAGGTTGCGATGGATCTACCGGACCCGAAAACGAGGAA
TGCTGGACTTGGAACTAG
Transcript >Hirsu2|3027
ATGCTCGGCCCATCCATACTGCTTTTCGCTGCTGGGGCCAGTGCGATCCTCAACGGCTTGGTCTCACAAGTTGTG
GTCGACGACGACCCTGCGAAGGACAAATACGTCTGTCCCTTGAACTGTATCTTTCGCATCGGCTACTTTATGGAC
AACGGTATCTCTTGCGGTAGCAACAAGGTCGTCGTTCTGGAGTCGTTCGAGCGACCCCCAATCCGCACCCTTTTC
CACGTCTGTAATGGATCGACACCCGAGTCGCAACTCGACCGCTGGCGAGAGCGCGAGCTCCGGGACGGAGAAGAG
CCCCCGCTGTGCGACGTAGGGAAAGCAGAGGACCCGTACGCACCCACAATCTGCATGTCTTTCAAATTTGGGAAT
AGCACAGAACCAGGAGTTATAAGAAATTACACCGATTTGCGCCCACAGCTCGAAGCCGATTTCTTCGGTGTGGCT
GGTCGAACACCCCCGCCAGCCGCTGAACAAGCCTCCGCAGGTTGCGATGGATCTACCGGACCCGAAAACGAGGAA
TGCTGGACTTGGAACTAG
Gene >Hirsu2|3027
ATGCTCGGCCCATCCATACTGCTTTTCGCTGCTGGGGCCAGTGCGATCCTCAACGGCTTGGTCTCACAAGTTGTG
GTCGACGACGACCCTGCGAAGGACAAATACGTCTGTCCCTTGAACTGTATCTTTCGCATCGGCTACTTTATGGAC
AACGGTATCTCTTGCGGTAGCAACAAGGTCGTCGTTCTGGAGTCGTTCGAGCGACCCCCAATCCGCACCCTTTTC
CACGTCTGTAATGGATCGACACCCGAGTCGCAACTCGACCGCTGGCGAGAGCGCGAGCTCCGGGACGGAGAAGAG
CCCCCGCTGTGCGACGTAGGGAAAGCAGAGGACCCGTACGCACCCACAATCTGCATGTCTTTCAAATTTGGGAAT
AGCACAGAACCAGGAGTTATAAGAAATTACACCGATTTGCGCCCACAGCTCGAAGCCGATTTCTTCGGTGTGGCT
GGTCGAACACCCCCGCCAGCCGCTGAACAAGCCTCCGCAGGTTGCGATGGATCTACCGGACCCGAAAACGAGGAA
TGCTGGACTTGGAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail