Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3016
Gene name
LocationContig_1765:2133..3717
Strand-
Gene length (bp)1584
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03366 YEATS YEATS family 2.6E-20 27 107
PF17035 BET Bromodomain extra-terminal - transcription regulation 4.0E-05 160 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF14 PE=1 SV=1 3 220 5.0E-54
sp|O94436|TAF14_SCHPO Transcription initiation factor TFIID subunit 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg3 PE=1 SV=1 3 221 9.0E-46
sp|Q99314|SAS5_YEAST Something about silencing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS5 PE=1 SV=1 3 214 7.0E-19
sp|Q6FXM4|AF9_CANGA Protein AF-9 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAF9 PE=3 SV=1 51 140 7.0E-09
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 51 155 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF14 PE=1 SV=1 3 220 5.0E-54
sp|O94436|TAF14_SCHPO Transcription initiation factor TFIID subunit 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg3 PE=1 SV=1 3 221 9.0E-46
sp|Q99314|SAS5_YEAST Something about silencing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS5 PE=1 SV=1 3 214 7.0E-19
sp|Q6FXM4|AF9_CANGA Protein AF-9 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAF9 PE=3 SV=1 51 140 7.0E-09
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 51 155 2.0E-07
sp|F4IPK2|TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana GN=TAF14 PE=1 SV=1 48 89 4.0E-07
sp|P53930|AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAF9 PE=1 SV=1 51 94 5.0E-07
sp|Q6CIV8|AF9_KLULA Protein AF-9 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAF9 PE=3 SV=1 51 139 7.0E-07
sp|Q4WPM8|AF9_ASPFU Protein AF-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yaf9 PE=3 SV=2 51 155 1.0E-06
sp|Q59LC9|AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAF9 PE=3 SV=1 51 105 2.0E-06
sp|Q6CF24|AF9_YARLI Protein AF-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAF9 PE=3 SV=1 51 89 3.0E-06
sp|Q755P0|AF9_ASHGO Protein AF-9 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAF9 PE=3 SV=1 51 94 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3016
MLVERKIKVVTDQHVVDKTSPMSEFPMREWSLRLHMLDENGQERPADVFTKVVYHLHPTFDNPVQTFTKPPFLCT
NEGWGEFEISIECYTTEKTKLAPIIHDLNFLKEKYEVVHTVVFKNPSQALQERLRETGPLPTDEDRPKKKGLVAK
KATQKYDYEKIADALEKLEEEDLLRVIQLINENKGPDTYIRSDVEAGEFSIDLYTMPDLLTTKLWEHLTKKGLVS
*
Coding >Hirsu2|3016
ATGTTGGTCGAGCGAAAGATCAAGGTCGTCACCGACCAGCATGTTGTTGACAAGACGTCGCCCATGTCCGAGTTT
CCCATGCGAGAATGGAGCTTGCGGCTGCACATGCTCGACGAAAACGGCCAGGAGCGCCCGGCCGATGTCTTCACA
AAGGTCGTCTACCATCTCCACCCCACGTTTGACAACCCTGTCCAGACCTTTACGAAGCCGCCTTTCCTCTGCACA
AACGAAGGCTGGGGCGAGTTCGAGATCAGCATCGAATGTTACACGACGGAGAAGACCAAGCTGGCACCCATCATA
CACGACCTGAATTTCCTCAAGGAGAAGTACGAGGTTGTACACACGGTCGTGTTTAAGAACCCGTCGCAGGCACTG
CAGGAGCGGCTGCGCGAGACGGGACCCCTGCCCACGGACGAGGACCGGCCCAAGAAGAAGGGCCTGGTGGCCAAG
AAGGCGACGCAGAAGTACGATTACGAGAAGATCGCCGATGCGCTGGAGAAGCTCGAGGAGGAGGACTTGCTGCGC
GTCATACAGCTCATCAACGAGAACAAGGGCCCCGACACGTACATCAGGAGCGATGTCGAAGCGGGCGAGTTCTCC
ATCGACCTGTACACGATGCCGGACCTGCTGACGACAAAACTCTGGGAGCACCTGACCAAGAAGGGTCTCGTGAGC
TAG
Transcript >Hirsu2|3016
ATGTTGGTCGAGCGAAAGATCAAGGTCGTCACCGACCAGCATGTTGTTGACAAGACGTCGCCCATGTCCGAGTTT
CCCATGCGAGAATGGAGCTTGCGGCTGCACATGCTCGACGAAAACGGCCAGGAGCGCCCGGCCGATGTCTTCACA
AAGGTCGTCTACCATCTCCACCCCACGTTTGACAACCCTGTCCAGACCTTTACGAAGCCGCCTTTCCTCTGCACA
AACGAAGGCTGGGGCGAGTTCGAGATCAGCATCGAATGTTACACGACGGAGAAGACCAAGCTGGCACCCATCATA
CACGACCTGAATTTCCTCAAGGAGAAGTACGAGGTTGTACACACGGTCGTGTTTAAGAACCCGTCGCAGGCACTG
CAGGAGCGGCTGCGCGAGACGGGACCCCTGCCCACGGACGAGGACCGGCCCAAGAAGAAGGGCCTGGTGGCCAAG
AAGGCGACGCAGAAGTACGATTACGAGAAGATCGCCGATGCGCTGGAGAAGCTCGAGGAGGAGGACTTGCTGCGC
GTCATACAGCTCATCAACGAGAACAAGGGCCCCGACACGTACATCAGGAGCGATGTCGAAGCGGGCGAGTTCTCC
ATCGACCTGTACACGATGCCGGACCTGCTGACGACAAAACTCTGGGAGCACCTGACCAAGAAGGGTCTCGTGAGC
TAG
Gene >Hirsu2|3016
ATGTTGGTCGAGGTGAGTCGGAGTGCTTCCGCCTGGCGACGGGCTGCCTTTTCGAGATCTTCTTCTCCGTCTTCT
TGTTTTTTTCTTTTTTTTGGTTTCCCCCCCTTTGTTGTTCTCCGTGGCTTTCTACCTCGGGCTCGGCGGGATGAA
GAGGGACGAAAGAGTGAGGCTATCCGCAGCCGACGGGGATGCATTGCGCGAGAGGGCCGGTCGTTGGGCCGGCAA
CCGGACACCTTTTGAACGGGCTCCCGGACGCGAGTCACTGGCCACGCGCAGCAGTGCGAGCCTTTCGTTCCGCTC
GGCCTACTTGCTCGCCGCGTCTCTGCTGTCCCGTTTGCTCTTGCGCTCTGCCTCCCGCCGACTGCCGGCAATGCC
GCTTTTCCTCTCCTCCCGGCCTGGCAGCAATGAGCGCGCCCGCGGGAGAGTGAAAAAAAAACACACGAAACCCCT
TGCCTTGCTCTGCCTCTCCGTCTTTTTCTCTTGCGCCCACTTTTACACGAGTCGAACATCGGCAGAAGATATTGC
TGCATCTGCAGCACTGCCCCGTTCCGAGAGCCATGGCGCCCTCTGAGCGGAAGAGGCCCAGGATCAAGTGGAAGA
AGCGCGCTGACAGCCTGCAGCGAAAGATCAAGGTCGTCACCGACCAGCATGTTGTGTAAGGGCCCCCGGCTTCCC
TTTCGGCCCGTCCGCCCGCCGAGGAGGCTGACTGACGATGGCCTACAGTGACAAGACGTCGCCCATGTCCGAGTT
TCCCATGCGAGAATGGAGCTTGCGGCTGCACATGCTCGACGAAAACGGCCAGGAGCGCCCGGCCGATGTCTTCAC
AAAGGTCGTCTACCATCTCCACCCCACGTTTGACAACCCTGTCCAGAGTCAGTCAGCCCCCTCCCCCCTTCCCCC
ATCGAGCTGCCCCTGCGATGGACTCTGCGTTTCTGACCAGCTGGCGAGCCGACAGCCTTTACGAAGCCGCCTTTC
CTCTGCACAAACGAAGGCTGGGGCGAGTTCGAGATCAGCATCGAATGTTACACGACGGAGAAGACCAAGCTGGCA
CCCATCATACACGACCTGAATTTCCTCAAGGAGAAGTACGAGGTTGTACACACGGTCGTGTTTAAGAACCCGTCG
CAGGCACTGCAGGAGCGGCTGCGCGAGACGGGACCCCTGCCCACGGACGAGGACCGGCCCAAGAAGAAGGGCCTG
GTGGCCAAGAAGGCGACGCAGAAGTACGATTACGAGAAGATCGCCGATGCGCTGGAGAAGCTCGAGGAGGAGGAC
TTGCTGCGCGTCATACAGCTCATCAACGAGAACAAGGGCCCCGACACGTACATCAGGAGCGATGTCGAAGGTAGG
CCTTCCCGCCGCGCCCCGGTTGGATGTCGTCTCCTCGTTTTGTTGATGCAGGGGTGCTAATAATAGTTGACAACC
TGGCCGAAGCGGGCGAGTTCTCCATCGACCTGTACACGATGCCGGACCTGCTGACGACAAAACTCTGGGAGCACC
TGGTGAGTCGGATCCTCCGCCGCGCACCGTACGACTGGGTAGCTGACGAGTCGTTGTCAGACCAAGAAGGGTCTC
GTGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail