Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3007
Gene name
LocationContig_1761:833..4163
Strand+
Gene length (bp)3330
Transcript length (bp)3330
Coding sequence length (bp)3330
Protein length (aa) 1110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2722 0.9031 0.2917 0.0459 0.0889 0.0466 0.0298 0.0112 0.0178 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6551
Ophiocordyceps australis 1348a (Ghana) OphauG2|6552
Ophiocordyceps australis map64 (Brazil) OphauB2|1204
Ophiocordyceps camponoti-floridani Ophcf2|02797
Ophiocordyceps camponoti-rufipedis Ophun1|1250
Ophiocordyceps camponoti-rufipedis Ophun1|7284
Ophiocordyceps kimflemingae Ophio5|7111
Ophiocordyceps subramaniannii Hirsu2|3007 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3007
MELDSTRDRAGPLTRAQAASRMAAGTESYYPSEETLGELRALAEATAGAGPQPQHHPHPQDRPRTRSQTGAQTEA
GPRTRAPNPPRGSKRKRGPAGAGGRPAKRSKSRRPDDDDDYMSDAGPHDDDDDGGGGDSEPDPSVRAGSVAPGGR
ICDFCSNDPDGRRAHEQRACDWKNGKYPLECSNCANHRLAGHPDHACAVPRKKKVWRRYADGHPADFQPAGCDEC
VAKDFGGACDVDVHLGYSCGECRKSKCHVGGVLVETRPNLRQGFQRWFRHACDVCRNLKPRRGQPGCSWLRDRTS
WDRPCQRCVDLVMTCTDSGVLIAHPAEPKVPAAWAVSHSLDDGWLDLRGITPWRPNCDHCGLAGNHCRVTAVAAQ
SACNKCFQMGLDCTDVRGGRWPISDLSRVGFGNFMPFSACGRCKTEGRNCDHQRPCDSCVEHGEGELCDKFKQGS
DKNVNCINGRLDPAPGPLYYLALGYGPGGVNDVKDGSRIEHWIGPAVPLYAMRGCIDETHRDDNKMAIVALVEAM
RKTLLPDGPPPHGGRGGRLEGRLPSSFTTDELAAMIVEMWPDAYPPRDHPKYDDAVDDARTARADLTGDQPRRRR
TRRARPGSSAAPASAPNANADESTAQPLAGAPQPASNNMPMAQLTMRQIYFHLCNSCAATATEMTENLAVWLFNK
GFRSVISIGALLGCLHSIGYLDQPNGECLSVWVALSNQDLDIFGPEHPSLTGNAPAGQASASAEQQASAANASAN
AGTQGQQPDVPLDPALEQAQAIPQSQLQLVPLAQQNPQPGWWDSAIMDGGREDRWRAARPAPAPGSQRPAIMLFA
SRQPLTMPNPIKDQLDVLDETALPACVAGDTVPCTDFGDGPHGLCGKPTAPEDRCQMRDHVEGDDPLRLGEHVCD
ECNQDGVDRLVDPNVRPITPDDMKSLRAYLCGECAARCSGSISGAVTDFIQHGTTQVWGCAFADDTMVDGQLFVN
GCDLVLRSGTMPVTGCRCATRLMSSRLCRWHRRRLAEKLIRHMAAVRQWRIAEHGLECCPGCLLRKPVDQANTSE
PGPAHIMRTEAWICMNCNGAVVCQPNRGLIGGQRSWFTNEPEAWQADFDEAMWLDRRAS*
Coding >Hirsu2|3007
ATGGAGCTGGACTCCACACGGGACCGGGCCGGTCCCCTGACCCGGGCCCAGGCCGCCTCCCGCATGGCTGCGGGG
ACCGAGTCGTACTATCCGAGCGAGGAAACGCTTGGTGAGCTGAGGGCGCTGGCCGAGGCCACGGCTGGGGCCGGT
CCTCAACCTCAGCACCATCCTCACCCTCAGGACAGGCCTCGGACCAGGAGCCAAACCGGGGCCCAGACCGAGGCC
GGGCCCCGGACTCGAGCGCCCAACCCGCCCAGGGGCTCCAAGCGTAAGCGCGGGCCGGCCGGCGCCGGTGGCAGG
CCGGCGAAAAGGTCGAAATCGAGGAGGCCAGACGACGACGATGATTATATGAGCGACGCCGGCCCCCACGACGAT
GACGACGACGGCGGCGGCGGCGACAGCGAGCCTGATCCGTCCGTCAGGGCCGGGTCCGTCGCGCCGGGCGGCCGC
ATCTGCGACTTCTGCTCCAACGACCCGGACGGCAGACGGGCGCACGAGCAGAGGGCGTGCGACTGGAAGAACGGC
AAATACCCCCTCGAGTGCTCCAACTGCGCCAACCACCGGCTCGCCGGCCACCCGGACCACGCGTGCGCCGTCCCC
CGCAAGAAGAAGGTGTGGCGGCGGTACGCCGACGGCCACCCGGCCGACTTCCAGCCGGCCGGCTGCGACGAGTGC
GTGGCCAAGGACTTCGGCGGCGCGTGCGACGTCGACGTCCACCTGGGCTACTCGTGCGGCGAGTGCCGCAAGAGC
AAGTGCCACGTCGGCGGCGTCCTCGTCGAGACGCGGCCCAACCTGCGGCAGGGCTTCCAGCGCTGGTTCCGCCAC
GCCTGCGACGTCTGCCGCAACCTCAAGCCCCGGCGCGGCCAGCCCGGCTGCAGCTGGCTCCGCGACCGCACCTCG
TGGGACCGGCCGTGCCAGCGCTGCGTCGACCTGGTCATGACCTGCACCGACTCGGGCGTCCTCATCGCCCACCCG
GCCGAGCCCAAGGTCCCCGCCGCCTGGGCCGTCTCGCACAGCCTCGACGACGGCTGGCTCGACCTCCGGGGCATC
ACCCCCTGGCGCCCCAACTGCGACCACTGCGGCCTCGCCGGCAACCACTGCCGCGTCACCGCCGTCGCCGCCCAG
TCCGCCTGCAACAAGTGCTTCCAGATGGGCCTCGACTGCACCGACGTCCGCGGCGGCCGCTGGCCCATCTCCGAC
CTGAGCCGCGTCGGCTTCGGCAACTTCATGCCCTTCTCCGCCTGCGGCCGCTGCAAGACCGAGGGCCGCAACTGC
GACCACCAGCGGCCGTGCGACTCGTGCGTCGAGCATGGCGAGGGGGAGCTGTGCGACAAGTTCAAACAGGGCTCG
GACAAGAACGTCAACTGCATCAACGGCCGGCTCGATCCCGCCCCGGGCCCCCTTTACTATCTGGCGCTGGGGTAC
GGCCCCGGCGGCGTCAACGACGTCAAGGACGGCTCCCGCATCGAGCACTGGATCGGCCCCGCCGTCCCCCTGTAC
GCCATGCGGGGCTGCATCGACGAGACCCATCGGGACGATAACAAGATGGCCATCGTGGCGCTGGTCGAAGCCATG
CGCAAGACCCTGCTTCCGGACGGCCCGCCGCCGCACGGCGGCCGCGGCGGCCGCCTCGAGGGGAGGCTCCCGAGC
AGCTTCACGACCGACGAGCTGGCTGCCATGATAGTCGAGATGTGGCCGGACGCGTACCCGCCCAGGGACCACCCG
AAATATGATGATGCCGTGGACGACGCGAGGACAGCGAGGGCCGACTTGACTGGGGACCAACCCCGTAGACGGCGC
ACCAGACGAGCCCGCCCCGGCTCCTCCGCCGCCCCGGCCTCCGCCCCAAACGCCAACGCCGACGAATCCACGGCA
CAGCCCTTAGCTGGTGCGCCCCAACCGGCCTCCAACAACATGCCGATGGCCCAGCTGACGATGCGACAGATATAT
TTTCATCTTTGCAACTCCTGCGCCGCGACCGCAACCGAAATGACGGAGAACCTGGCCGTCTGGCTTTTTAACAAG
GGCTTCAGATCGGTCATTTCCATTGGCGCGCTGCTCGGCTGCCTTCATTCGATCGGGTATTTGGATCAGCCTAAC
GGTGAGTGCCTGTCCGTCTGGGTCGCGCTGTCCAACCAAGATCTTGATATTTTCGGCCCTGAACACCCAAGCCTG
ACTGGAAACGCCCCGGCCGGCCAGGCGAGTGCGTCAGCGGAACAACAAGCGTCGGCCGCAAACGCGAGCGCAAAC
GCCGGCACGCAGGGCCAGCAGCCAGACGTGCCCTTGGATCCCGCACTGGAGCAGGCTCAAGCGATCCCCCAGAGC
CAACTGCAGCTCGTCCCTCTCGCGCAGCAAAACCCACAGCCCGGCTGGTGGGACAGCGCGATCATGGACGGCGGC
CGCGAGGACCGGTGGCGGGCGGCACGCCCCGCGCCCGCCCCCGGGAGCCAACGTCCGGCCATCATGCTCTTCGCG
TCGCGCCAGCCGCTGACGATGCCGAATCCGATCAAGGACCAGCTGGACGTGCTGGACGAGACGGCGCTCCCCGCG
TGCGTGGCGGGCGACACGGTCCCGTGCACCGATTTCGGCGACGGCCCCCACGGCCTGTGCGGAAAGCCGACGGCG
CCCGAGGACAGGTGCCAGATGAGGGACCACGTCGAGGGCGACGACCCGCTGCGGCTGGGCGAGCATGTCTGCGAC
GAGTGCAACCAGGACGGCGTCGACCGGCTCGTCGACCCCAACGTCCGCCCCATCACGCCGGACGACATGAAGAGC
CTCCGGGCCTACCTCTGCGGCGAGTGCGCGGCCAGGTGCAGCGGAAGCATCTCGGGCGCCGTGACCGACTTCATC
CAGCACGGCACCACGCAGGTCTGGGGCTGCGCCTTCGCCGACGACACCATGGTCGACGGTCAGCTCTTCGTCAAC
GGCTGCGACCTGGTCCTCCGCAGCGGGACGATGCCCGTCACGGGCTGCCGCTGCGCGACCCGGCTCATGTCCTCG
CGTCTCTGCCGCTGGCACCGCAGGCGCCTTGCCGAGAAGCTCATCCGCCACATGGCCGCGGTCCGGCAGTGGCGC
ATTGCCGAACACGGCCTGGAGTGTTGCCCGGGCTGCCTCCTCCGCAAGCCGGTCGATCAGGCGAACACGTCGGAG
CCCGGTCCGGCCCACATCATGAGGACAGAGGCGTGGATCTGCATGAACTGCAACGGCGCCGTCGTCTGTCAGCCG
AACCGCGGCCTGATTGGCGGGCAGCGGTCGTGGTTCACCAACGAACCCGAGGCTTGGCAGGCCGATTTCGACGAG
GCTATGTGGCTAGACAGGAGGGCATCGTGA
Transcript >Hirsu2|3007
ATGGAGCTGGACTCCACACGGGACCGGGCCGGTCCCCTGACCCGGGCCCAGGCCGCCTCCCGCATGGCTGCGGGG
ACCGAGTCGTACTATCCGAGCGAGGAAACGCTTGGTGAGCTGAGGGCGCTGGCCGAGGCCACGGCTGGGGCCGGT
CCTCAACCTCAGCACCATCCTCACCCTCAGGACAGGCCTCGGACCAGGAGCCAAACCGGGGCCCAGACCGAGGCC
GGGCCCCGGACTCGAGCGCCCAACCCGCCCAGGGGCTCCAAGCGTAAGCGCGGGCCGGCCGGCGCCGGTGGCAGG
CCGGCGAAAAGGTCGAAATCGAGGAGGCCAGACGACGACGATGATTATATGAGCGACGCCGGCCCCCACGACGAT
GACGACGACGGCGGCGGCGGCGACAGCGAGCCTGATCCGTCCGTCAGGGCCGGGTCCGTCGCGCCGGGCGGCCGC
ATCTGCGACTTCTGCTCCAACGACCCGGACGGCAGACGGGCGCACGAGCAGAGGGCGTGCGACTGGAAGAACGGC
AAATACCCCCTCGAGTGCTCCAACTGCGCCAACCACCGGCTCGCCGGCCACCCGGACCACGCGTGCGCCGTCCCC
CGCAAGAAGAAGGTGTGGCGGCGGTACGCCGACGGCCACCCGGCCGACTTCCAGCCGGCCGGCTGCGACGAGTGC
GTGGCCAAGGACTTCGGCGGCGCGTGCGACGTCGACGTCCACCTGGGCTACTCGTGCGGCGAGTGCCGCAAGAGC
AAGTGCCACGTCGGCGGCGTCCTCGTCGAGACGCGGCCCAACCTGCGGCAGGGCTTCCAGCGCTGGTTCCGCCAC
GCCTGCGACGTCTGCCGCAACCTCAAGCCCCGGCGCGGCCAGCCCGGCTGCAGCTGGCTCCGCGACCGCACCTCG
TGGGACCGGCCGTGCCAGCGCTGCGTCGACCTGGTCATGACCTGCACCGACTCGGGCGTCCTCATCGCCCACCCG
GCCGAGCCCAAGGTCCCCGCCGCCTGGGCCGTCTCGCACAGCCTCGACGACGGCTGGCTCGACCTCCGGGGCATC
ACCCCCTGGCGCCCCAACTGCGACCACTGCGGCCTCGCCGGCAACCACTGCCGCGTCACCGCCGTCGCCGCCCAG
TCCGCCTGCAACAAGTGCTTCCAGATGGGCCTCGACTGCACCGACGTCCGCGGCGGCCGCTGGCCCATCTCCGAC
CTGAGCCGCGTCGGCTTCGGCAACTTCATGCCCTTCTCCGCCTGCGGCCGCTGCAAGACCGAGGGCCGCAACTGC
GACCACCAGCGGCCGTGCGACTCGTGCGTCGAGCATGGCGAGGGGGAGCTGTGCGACAAGTTCAAACAGGGCTCG
GACAAGAACGTCAACTGCATCAACGGCCGGCTCGATCCCGCCCCGGGCCCCCTTTACTATCTGGCGCTGGGGTAC
GGCCCCGGCGGCGTCAACGACGTCAAGGACGGCTCCCGCATCGAGCACTGGATCGGCCCCGCCGTCCCCCTGTAC
GCCATGCGGGGCTGCATCGACGAGACCCATCGGGACGATAACAAGATGGCCATCGTGGCGCTGGTCGAAGCCATG
CGCAAGACCCTGCTTCCGGACGGCCCGCCGCCGCACGGCGGCCGCGGCGGCCGCCTCGAGGGGAGGCTCCCGAGC
AGCTTCACGACCGACGAGCTGGCTGCCATGATAGTCGAGATGTGGCCGGACGCGTACCCGCCCAGGGACCACCCG
AAATATGATGATGCCGTGGACGACGCGAGGACAGCGAGGGCCGACTTGACTGGGGACCAACCCCGTAGACGGCGC
ACCAGACGAGCCCGCCCCGGCTCCTCCGCCGCCCCGGCCTCCGCCCCAAACGCCAACGCCGACGAATCCACGGCA
CAGCCCTTAGCTGGTGCGCCCCAACCGGCCTCCAACAACATGCCGATGGCCCAGCTGACGATGCGACAGATATAT
TTTCATCTTTGCAACTCCTGCGCCGCGACCGCAACCGAAATGACGGAGAACCTGGCCGTCTGGCTTTTTAACAAG
GGCTTCAGATCGGTCATTTCCATTGGCGCGCTGCTCGGCTGCCTTCATTCGATCGGGTATTTGGATCAGCCTAAC
GGTGAGTGCCTGTCCGTCTGGGTCGCGCTGTCCAACCAAGATCTTGATATTTTCGGCCCTGAACACCCAAGCCTG
ACTGGAAACGCCCCGGCCGGCCAGGCGAGTGCGTCAGCGGAACAACAAGCGTCGGCCGCAAACGCGAGCGCAAAC
GCCGGCACGCAGGGCCAGCAGCCAGACGTGCCCTTGGATCCCGCACTGGAGCAGGCTCAAGCGATCCCCCAGAGC
CAACTGCAGCTCGTCCCTCTCGCGCAGCAAAACCCACAGCCCGGCTGGTGGGACAGCGCGATCATGGACGGCGGC
CGCGAGGACCGGTGGCGGGCGGCACGCCCCGCGCCCGCCCCCGGGAGCCAACGTCCGGCCATCATGCTCTTCGCG
TCGCGCCAGCCGCTGACGATGCCGAATCCGATCAAGGACCAGCTGGACGTGCTGGACGAGACGGCGCTCCCCGCG
TGCGTGGCGGGCGACACGGTCCCGTGCACCGATTTCGGCGACGGCCCCCACGGCCTGTGCGGAAAGCCGACGGCG
CCCGAGGACAGGTGCCAGATGAGGGACCACGTCGAGGGCGACGACCCGCTGCGGCTGGGCGAGCATGTCTGCGAC
GAGTGCAACCAGGACGGCGTCGACCGGCTCGTCGACCCCAACGTCCGCCCCATCACGCCGGACGACATGAAGAGC
CTCCGGGCCTACCTCTGCGGCGAGTGCGCGGCCAGGTGCAGCGGAAGCATCTCGGGCGCCGTGACCGACTTCATC
CAGCACGGCACCACGCAGGTCTGGGGCTGCGCCTTCGCCGACGACACCATGGTCGACGGTCAGCTCTTCGTCAAC
GGCTGCGACCTGGTCCTCCGCAGCGGGACGATGCCCGTCACGGGCTGCCGCTGCGCGACCCGGCTCATGTCCTCG
CGTCTCTGCCGCTGGCACCGCAGGCGCCTTGCCGAGAAGCTCATCCGCCACATGGCCGCGGTCCGGCAGTGGCGC
ATTGCCGAACACGGCCTGGAGTGTTGCCCGGGCTGCCTCCTCCGCAAGCCGGTCGATCAGGCGAACACGTCGGAG
CCCGGTCCGGCCCACATCATGAGGACAGAGGCGTGGATCTGCATGAACTGCAACGGCGCCGTCGTCTGTCAGCCG
AACCGCGGCCTGATTGGCGGGCAGCGGTCGTGGTTCACCAACGAACCCGAGGCTTGGCAGGCCGATTTCGACGAG
GCTATGTGGCTAGACAGGAGGGCATCGTGA
Gene >Hirsu2|3007
ATGGAGCTGGACTCCACACGGGACCGGGCCGGTCCCCTGACCCGGGCCCAGGCCGCCTCCCGCATGGCTGCGGGG
ACCGAGTCGTACTATCCGAGCGAGGAAACGCTTGGTGAGCTGAGGGCGCTGGCCGAGGCCACGGCTGGGGCCGGT
CCTCAACCTCAGCACCATCCTCACCCTCAGGACAGGCCTCGGACCAGGAGCCAAACCGGGGCCCAGACCGAGGCC
GGGCCCCGGACTCGAGCGCCCAACCCGCCCAGGGGCTCCAAGCGTAAGCGCGGGCCGGCCGGCGCCGGTGGCAGG
CCGGCGAAAAGGTCGAAATCGAGGAGGCCAGACGACGACGATGATTATATGAGCGACGCCGGCCCCCACGACGAT
GACGACGACGGCGGCGGCGGCGACAGCGAGCCTGATCCGTCCGTCAGGGCCGGGTCCGTCGCGCCGGGCGGCCGC
ATCTGCGACTTCTGCTCCAACGACCCGGACGGCAGACGGGCGCACGAGCAGAGGGCGTGCGACTGGAAGAACGGC
AAATACCCCCTCGAGTGCTCCAACTGCGCCAACCACCGGCTCGCCGGCCACCCGGACCACGCGTGCGCCGTCCCC
CGCAAGAAGAAGGTGTGGCGGCGGTACGCCGACGGCCACCCGGCCGACTTCCAGCCGGCCGGCTGCGACGAGTGC
GTGGCCAAGGACTTCGGCGGCGCGTGCGACGTCGACGTCCACCTGGGCTACTCGTGCGGCGAGTGCCGCAAGAGC
AAGTGCCACGTCGGCGGCGTCCTCGTCGAGACGCGGCCCAACCTGCGGCAGGGCTTCCAGCGCTGGTTCCGCCAC
GCCTGCGACGTCTGCCGCAACCTCAAGCCCCGGCGCGGCCAGCCCGGCTGCAGCTGGCTCCGCGACCGCACCTCG
TGGGACCGGCCGTGCCAGCGCTGCGTCGACCTGGTCATGACCTGCACCGACTCGGGCGTCCTCATCGCCCACCCG
GCCGAGCCCAAGGTCCCCGCCGCCTGGGCCGTCTCGCACAGCCTCGACGACGGCTGGCTCGACCTCCGGGGCATC
ACCCCCTGGCGCCCCAACTGCGACCACTGCGGCCTCGCCGGCAACCACTGCCGCGTCACCGCCGTCGCCGCCCAG
TCCGCCTGCAACAAGTGCTTCCAGATGGGCCTCGACTGCACCGACGTCCGCGGCGGCCGCTGGCCCATCTCCGAC
CTGAGCCGCGTCGGCTTCGGCAACTTCATGCCCTTCTCCGCCTGCGGCCGCTGCAAGACCGAGGGCCGCAACTGC
GACCACCAGCGGCCGTGCGACTCGTGCGTCGAGCATGGCGAGGGGGAGCTGTGCGACAAGTTCAAACAGGGCTCG
GACAAGAACGTCAACTGCATCAACGGCCGGCTCGATCCCGCCCCGGGCCCCCTTTACTATCTGGCGCTGGGGTAC
GGCCCCGGCGGCGTCAACGACGTCAAGGACGGCTCCCGCATCGAGCACTGGATCGGCCCCGCCGTCCCCCTGTAC
GCCATGCGGGGCTGCATCGACGAGACCCATCGGGACGATAACAAGATGGCCATCGTGGCGCTGGTCGAAGCCATG
CGCAAGACCCTGCTTCCGGACGGCCCGCCGCCGCACGGCGGCCGCGGCGGCCGCCTCGAGGGGAGGCTCCCGAGC
AGCTTCACGACCGACGAGCTGGCTGCCATGATAGTCGAGATGTGGCCGGACGCGTACCCGCCCAGGGACCACCCG
AAATATGATGATGCCGTGGACGACGCGAGGACAGCGAGGGCCGACTTGACTGGGGACCAACCCCGTAGACGGCGC
ACCAGACGAGCCCGCCCCGGCTCCTCCGCCGCCCCGGCCTCCGCCCCAAACGCCAACGCCGACGAATCCACGGCA
CAGCCCTTAGCTGGTGCGCCCCAACCGGCCTCCAACAACATGCCGATGGCCCAGCTGACGATGCGACAGATATAT
TTTCATCTTTGCAACTCCTGCGCCGCGACCGCAACCGAAATGACGGAGAACCTGGCCGTCTGGCTTTTTAACAAG
GGCTTCAGATCGGTCATTTCCATTGGCGCGCTGCTCGGCTGCCTTCATTCGATCGGGTATTTGGATCAGCCTAAC
GGTGAGTGCCTGTCCGTCTGGGTCGCGCTGTCCAACCAAGATCTTGATATTTTCGGCCCTGAACACCCAAGCCTG
ACTGGAAACGCCCCGGCCGGCCAGGCGAGTGCGTCAGCGGAACAACAAGCGTCGGCCGCAAACGCGAGCGCAAAC
GCCGGCACGCAGGGCCAGCAGCCAGACGTGCCCTTGGATCCCGCACTGGAGCAGGCTCAAGCGATCCCCCAGAGC
CAACTGCAGCTCGTCCCTCTCGCGCAGCAAAACCCACAGCCCGGCTGGTGGGACAGCGCGATCATGGACGGCGGC
CGCGAGGACCGGTGGCGGGCGGCACGCCCCGCGCCCGCCCCCGGGAGCCAACGTCCGGCCATCATGCTCTTCGCG
TCGCGCCAGCCGCTGACGATGCCGAATCCGATCAAGGACCAGCTGGACGTGCTGGACGAGACGGCGCTCCCCGCG
TGCGTGGCGGGCGACACGGTCCCGTGCACCGATTTCGGCGACGGCCCCCACGGCCTGTGCGGAAAGCCGACGGCG
CCCGAGGACAGGTGCCAGATGAGGGACCACGTCGAGGGCGACGACCCGCTGCGGCTGGGCGAGCATGTCTGCGAC
GAGTGCAACCAGGACGGCGTCGACCGGCTCGTCGACCCCAACGTCCGCCCCATCACGCCGGACGACATGAAGAGC
CTCCGGGCCTACCTCTGCGGCGAGTGCGCGGCCAGGTGCAGCGGAAGCATCTCGGGCGCCGTGACCGACTTCATC
CAGCACGGCACCACGCAGGTCTGGGGCTGCGCCTTCGCCGACGACACCATGGTCGACGGTCAGCTCTTCGTCAAC
GGCTGCGACCTGGTCCTCCGCAGCGGGACGATGCCCGTCACGGGCTGCCGCTGCGCGACCCGGCTCATGTCCTCG
CGTCTCTGCCGCTGGCACCGCAGGCGCCTTGCCGAGAAGCTCATCCGCCACATGGCCGCGGTCCGGCAGTGGCGC
ATTGCCGAACACGGCCTGGAGTGTTGCCCGGGCTGCCTCCTCCGCAAGCCGGTCGATCAGGCGAACACGTCGGAG
CCCGGTCCGGCCCACATCATGAGGACAGAGGCGTGGATCTGCATGAACTGCAACGGCGCCGTCGTCTGTCAGCCG
AACCGCGGCCTGATTGGCGGGCAGCGGTCGTGGTTCACCAACGAACCCGAGGCTTGGCAGGCCGATTTCGACGAG
GCTATGTGGCTAGACAGGAGGGCATCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail