Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3001
Gene name
LocationContig_176:10436..11830
Strand-
Gene length (bp)1394
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.3E-06 294 360

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 128 341 2.0E-08
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 268 341 3.0E-08
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 161 341 4.0E-08
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 164 363 2.0E-07
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 129 341 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 128 341 2.0E-08
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 268 341 3.0E-08
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 161 341 4.0E-08
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 164 363 2.0E-07
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 129 341 2.0E-07
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 191 341 4.0E-07
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 273 370 1.0E-06
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 225 360 2.0E-06
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 140 372 3.0E-06
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 220 341 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3001
MDCRIKVSCGLALAVAICTLLYLISAFLRRPSASDKAVKEMIARHRSIADFKFFNAPLLPDRLRLRALPNARLIT
AFDIRNSLTTTDEAEHKAFLRRAVNAMRAADTPTWHRVQKRAGKTLDMLTSRLYEADKGGLGLERVARIVCFDAV
LEILFPHTRARLLDIDAADAATSNINRLWLESKKRQLDETSLQHVLKRLCVLLHHLLPGEDDTLALIIPAYETLW
RVVLLTYVHVAFRYVDDQTRAQVRDVVKSVSEIGLGAPLSIDVNQFAQEALRLYPPTKRIYRASDCGQVAADVEL
LHHDERIWGSDALDFRPCRFQILTRRQTEAYIPFGAGGNSCPAASGFGRKMIVLLVVAMIKRLGTAELRTRIWFC
DEELDGDDKAPLPTGRDKMGAWVISVDPVPKTWRRVDIGRGNQLGIVR*
Coding >Hirsu2|3001
ATGGACTGCCGTATAAAAGTTAGCTGCGGCCTCGCCTTGGCTGTCGCTATATGCACTCTCCTATATCTCATTTCA
GCTTTTCTCCGTCGACCCTCCGCCTCGGATAAGGCGGTCAAGGAAATGATTGCAAGACACAGGAGCATTGCGGAT
TTCAAATTCTTCAATGCGCCGCTGCTCCCTGACCGCCTGCGTCTTCGGGCTCTTCCGAATGCCCGTCTGATTACA
GCCTTTGATATCCGTAACTCGTTGACCACTACGGATGAAGCTGAGCATAAAGCGTTTCTCAGACGTGCCGTGAAT
GCCATGAGAGCAGCCGACACACCGACGTGGCATCGGGTCCAGAAACGAGCCGGTAAAACGCTCGATATGCTGACC
TCGCGGCTTTACGAAGCAGACAAAGGCGGACTGGGTTTGGAGCGCGTTGCCCGAATCGTGTGTTTTGACGCGGTG
CTGGAGATTCTCTTTCCCCACACGCGAGCGCGGCTCCTGGACATCGATGCAGCTGATGCTGCAACAAGCAACATC
AATCGCCTATGGCTTGAGTCGAAGAAGAGGCAGTTGGACGAGACGAGTCTGCAACACGTGCTGAAACGACTGTGT
GTGCTATTGCACCACCTGCTGCCTGGTGAAGACGATACTCTTGCGCTCATCATTCCCGCATACGAAACGCTCTGG
CGGGTCGTACTTTTGACCTACGTCCATGTTGCATTCCGCTACGTGGATGACCAGACTAGGGCTCAAGTGAGGGAC
GTCGTCAAGAGTGTGTCAGAAATAGGGCTGGGAGCACCGCTCTCCATCGACGTTAATCAGTTTGCTCAGGAGGCG
CTGCGTTTATACCCTCCAACGAAACGCATCTACCGCGCTTCGGACTGCGGCCAAGTGGCAGCAGACGTCGAGTTG
CTCCACCACGACGAGCGGATCTGGGGCTCCGATGCCCTCGACTTCCGGCCTTGCCGTTTCCAGATACTCACGCGG
AGACAGACGGAGGCGTACATACCCTTCGGAGCAGGCGGAAACTCTTGTCCGGCCGCCAGTGGCTTCGGCCGCAAG
ATGATTGTGCTCCTCGTTGTCGCGATGATTAAGCGACTTGGCACCGCAGAACTTCGGACTCGGATTTGGTTTTGT
GACGAGGAGCTAGATGGGGATGATAAAGCGCCGTTGCCAACTGGTCGAGACAAGATGGGGGCTTGGGTCATATCT
GTCGATCCAGTCCCGAAGACATGGAGAAGAGTTGATATCGGCCGTGGAAACCAGCTGGGGATTGTTCGATGA
Transcript >Hirsu2|3001
ATGGACTGCCGTATAAAAGTTAGCTGCGGCCTCGCCTTGGCTGTCGCTATATGCACTCTCCTATATCTCATTTCA
GCTTTTCTCCGTCGACCCTCCGCCTCGGATAAGGCGGTCAAGGAAATGATTGCAAGACACAGGAGCATTGCGGAT
TTCAAATTCTTCAATGCGCCGCTGCTCCCTGACCGCCTGCGTCTTCGGGCTCTTCCGAATGCCCGTCTGATTACA
GCCTTTGATATCCGTAACTCGTTGACCACTACGGATGAAGCTGAGCATAAAGCGTTTCTCAGACGTGCCGTGAAT
GCCATGAGAGCAGCCGACACACCGACGTGGCATCGGGTCCAGAAACGAGCCGGTAAAACGCTCGATATGCTGACC
TCGCGGCTTTACGAAGCAGACAAAGGCGGACTGGGTTTGGAGCGCGTTGCCCGAATCGTGTGTTTTGACGCGGTG
CTGGAGATTCTCTTTCCCCACACGCGAGCGCGGCTCCTGGACATCGATGCAGCTGATGCTGCAACAAGCAACATC
AATCGCCTATGGCTTGAGTCGAAGAAGAGGCAGTTGGACGAGACGAGTCTGCAACACGTGCTGAAACGACTGTGT
GTGCTATTGCACCACCTGCTGCCTGGTGAAGACGATACTCTTGCGCTCATCATTCCCGCATACGAAACGCTCTGG
CGGGTCGTACTTTTGACCTACGTCCATGTTGCATTCCGCTACGTGGATGACCAGACTAGGGCTCAAGTGAGGGAC
GTCGTCAAGAGTGTGTCAGAAATAGGGCTGGGAGCACCGCTCTCCATCGACGTTAATCAGTTTGCTCAGGAGGCG
CTGCGTTTATACCCTCCAACGAAACGCATCTACCGCGCTTCGGACTGCGGCCAAGTGGCAGCAGACGTCGAGTTG
CTCCACCACGACGAGCGGATCTGGGGCTCCGATGCCCTCGACTTCCGGCCTTGCCGTTTCCAGATACTCACGCGG
AGACAGACGGAGGCGTACATACCCTTCGGAGCAGGCGGAAACTCTTGTCCGGCCGCCAGTGGCTTCGGCCGCAAG
ATGATTGTGCTCCTCGTTGTCGCGATGATTAAGCGACTTGGCACCGCAGAACTTCGGACTCGGATTTGGTTTTGT
GACGAGGAGCTAGATGGGGATGATAAAGCGCCGTTGCCAACTGGTCGAGACAAGATGGGGGCTTGGGTCATATCT
GTCGATCCAGTCCCGAAGACATGGAGAAGAGTTGATATCGGCCGTGGAAACCAGCTGGGGATTGTTCGATGA
Gene >Hirsu2|3001
ATGGACTGCCGTATAAAAGTTAGCTGCGGCCTCGCCTTGGCTGTCGCTATATGCACTCTCCTATATCTCATTTCA
GCTTTTCTCCGTCGACCCTCCGCCTCGGATAAGGCGGTCAAGGAAATGATTGCAAGACACAGGAGCATTGCGGAT
TTCAAATTCTTCAATGCGCCGCTGCTCCCTGACCGCCTGCGTCTTCGGGCTCTTCCGAATGCCCGTCTGATTACA
GCCTTTGATATCCGTAACTCGTTGACCACTACGGATGAAGCTGAGCATAAAGCGTTTCTCAGACGTGCCGTGAAT
GCCATGAGAGCAGCCGACACACCGACGTGGCATCGGGTCCAGAAACGAGCCGGTAAAACGCTCGATATGCTGACC
TCGCGGCTTTACGAAGCAGACAAAGGCGGACTGGGTTTGGAGCGCGTTGCCCGAATCGTGTGTTTTGACGCGGTG
CTGGAGATTCTCTTTCCCCACACGCGAGCGCGGCTCCTGGACATCGATGCAGCTGATGCTGCAACAAGCAACATC
AATCGCCTATGGCTTGAGTCGAAGAAGAGGCAGTTGGACGAGACGAGTCTGCAACACGTGCTGAAACGACTGTGT
GTGCTATTGCACCACCTGCTGCCTGGTGAAGACGATACTCTTGCGCTCATCATTCCCGCATACGAAACGCTCTGG
CGGGTCGTACTTTTGACCTACGTCCATGTTGCATTCCGCTACGTGGATGACCAGACTAGGGCTCAAGTGAGGGAC
GTCGTCAAGAGTGTGTCAGAAATAGGGCTGGGAGCACCGCTCTCCATCGACGTTAATCAGTTTGCTCAGGTCCGT
ACAGAAATGAACCCCATGGCTTGCTCTCCACAATGCACAATGTCTACGTGGACCGAATATGGGAGTTTTGTAAAG
ACTGGATGAGAAATAAGGCTAAATATTCCTTTTTGCTCTAGGAGGCGCTGCGTTTATACCCTCCAACGAAACGCA
TCTACCGCGCTTCGGACTGCGGCCAAGTGGCAGCAGACGTCGAGTTGCTCCACCACGACGAGCGGATCTGGGGCT
CCGATGCCCTCGACTTCCGGCCTTGCCGTTTCCAGATACTCACGCGGAGACAGACGGAGGCGTACATACCCTTCG
GAGCAGGCGGAAACTCTTGTCCGGCCGCCAGTGGCTTCGGCCGCAAGATGATTGTGCTCCTCGTTGTCGCGATGA
TTAAGCGACTTGGCACCGCAGAACTTCGGACTCGGATTTGGTTTTGTGACGAGGAGCTAGATGGGGATGATAAAG
CGCCGTTGCCAACTGGTCGAGACAAGATGGGGGCTTGGGTCATATCTGTCGATCCAGTCCCGAAGACATGGAGAA
GAGTTGATATCGGCCGTGGAAACCAGCTGGGGATTGTTCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail