© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|30 |
| Gene name | |
| Location | Contig_100:7444..9174 |
| Strand | - |
| Gene length (bp) | 1730 |
| Transcript length (bp) | 1479 |
| Coding sequence length (bp) | 1479 |
| Protein length (aa) | 493 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 7.2E-07 | 32 | 164 |
| PF00067 | p450 | Cytochrome P450 | 8.0E-56 | 191 | 423 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|B8NHY4|ORDA_ASPFN | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 | 31 | 485 | 3.0E-87 |
| sp|Q5VDD6|ORDA_ASPFL | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 | 31 | 485 | 3.0E-87 |
| sp|O13345|ORDA_ASPPA | O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 | 31 | 485 | 5.0E-87 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 30 | 431 | 1.0E-34 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 12 | 420 | 5.0E-34 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|B8NHY4|ORDA_ASPFN | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 | 31 | 485 | 3.0E-87 |
| sp|Q5VDD6|ORDA_ASPFL | O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 | 31 | 485 | 3.0E-87 |
| sp|O13345|ORDA_ASPPA | O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 | 31 | 485 | 5.0E-87 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 30 | 431 | 1.0E-34 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 12 | 420 | 5.0E-34 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 8.0E-34 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 9 | 457 | 1.0E-33 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 12 | 420 | 1.0E-33 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 33 | 420 | 1.0E-33 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 33 | 420 | 2.0E-33 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 10 | 439 | 2.0E-33 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 6 | 455 | 2.0E-33 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 16 | 415 | 2.0E-33 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 16 | 455 | 4.0E-33 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 6 | 455 | 1.0E-32 |
| sp|O42231|CP1A1_LIZAU | Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 1.0E-32 |
| sp|P79760|CP1A4_CHICK | Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 | 32 | 423 | 1.0E-32 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 13 | 432 | 1.0E-32 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 30 | 455 | 2.0E-32 |
| sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 31 | 455 | 3.0E-32 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 30 | 455 | 5.0E-32 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 38 | 427 | 6.0E-32 |
| sp|O42457|CP1A1_SPAAU | Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 1.0E-31 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 30 | 455 | 2.0E-31 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 224 | 451 | 2.0E-31 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 30 | 420 | 2.0E-31 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 3.0E-31 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 19 | 438 | 3.0E-31 |
| sp|Q9W683|CP1A1_LIZSA | Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 4.0E-31 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 19 | 434 | 5.0E-31 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 224 | 434 | 6.0E-31 |
| sp|Q6JZS3|CP1A1_ORYLA | Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 | 16 | 416 | 1.0E-30 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 16 | 454 | 1.0E-30 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 20 | 445 | 2.0E-30 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 155 | 455 | 2.0E-30 |
| sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 33 | 408 | 3.0E-30 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 24 | 455 | 3.0E-30 |
| sp|P12791|CP2BA_MOUSE | Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 | 239 | 434 | 6.0E-30 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 239 | 431 | 6.0E-30 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 155 | 431 | 8.0E-30 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 32 | 468 | 1.0E-29 |
| sp|Q64583|CP2BF_RAT | Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 | 16 | 431 | 1.0E-29 |
| sp|O48928|C77A3_SOYBN | Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 | 5 | 462 | 1.0E-29 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 31 | 431 | 1.0E-29 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 254 | 434 | 1.0E-29 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 29 | 455 | 2.0E-29 |
| sp|P10610|CP2G1_RAT | Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 | 21 | 437 | 2.0E-29 |
| sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 10 | 431 | 3.0E-29 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 236 | 455 | 3.0E-29 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 10 | 455 | 4.0E-29 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 12 | 419 | 4.0E-29 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 155 | 455 | 4.0E-29 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 223 | 455 | 5.0E-29 |
| sp|Q01361|CP2DE_BOVIN | Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 | 32 | 419 | 8.0E-29 |
| sp|P20814|CP2CD_RAT | Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 | 31 | 454 | 1.0E-28 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 224 | 434 | 1.0E-28 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 25 | 420 | 1.0E-28 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 12 | 438 | 1.0E-28 |
| sp|Q92148|CP1A1_MICTO | Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 | 33 | 420 | 1.0E-28 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 145 | 455 | 2.0E-28 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 31 | 454 | 3.0E-28 |
| sp|P79716|CP1A1_DICLA | Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 | 33 | 415 | 4.0E-28 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 23 | 444 | 4.0E-28 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 10 | 457 | 4.0E-28 |
| sp|Q29473|CP2DF_CANLF | Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 | 12 | 419 | 4.0E-28 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 29 | 434 | 5.0E-28 |
| sp|P12938|CP2D3_RAT | Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 | 12 | 419 | 5.0E-28 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 31 | 431 | 7.0E-28 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 27 | 430 | 7.0E-28 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 137 | 420 | 7.0E-28 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 6 | 418 | 8.0E-28 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 236 | 455 | 8.0E-28 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 31 | 454 | 9.0E-28 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 60 | 452 | 1.0E-27 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 31 | 454 | 1.0E-27 |
| sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 12 | 419 | 1.0E-27 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 29 | 454 | 1.0E-27 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 16 | 454 | 1.0E-27 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 144 | 419 | 2.0E-27 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 196 | 455 | 2.0E-27 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 24 | 445 | 2.0E-27 |
| sp|P24470|CP2CN_RAT | Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 | 31 | 455 | 3.0E-27 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 23 | 457 | 3.0E-27 |
| sp|O57525|CP17A_RANDY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 | 38 | 435 | 3.0E-27 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 4 | 434 | 4.0E-27 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 218 | 434 | 4.0E-27 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 145 | 435 | 4.0E-27 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 147 | 419 | 5.0E-27 |
| sp|Q9QYG6|CP2DR_MESAU | Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 | 144 | 420 | 5.0E-27 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 6 | 455 | 6.0E-27 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 30 | 419 | 7.0E-27 |
| sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 9 | 426 | 9.0E-27 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 234 | 415 | 1.0E-26 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 10 | 457 | 1.0E-26 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 33 | 415 | 1.0E-26 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 38 | 455 | 2.0E-26 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 31 | 452 | 2.0E-26 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 144 | 415 | 2.0E-26 |
| sp|P24454|CP2A8_MESAU | Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 | 16 | 455 | 2.0E-26 |
| sp|A1DA63|FTME_NEOFI | Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 | 265 | 465 | 2.0E-26 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 9 | 420 | 2.0E-26 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 1 | 415 | 2.0E-26 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 247 | 431 | 2.0E-26 |
| sp|Q3LFT9|CP1A2_BALAC | Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 | 32 | 415 | 2.0E-26 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 1 | 403 | 2.0E-26 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 144 | 415 | 3.0E-26 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 30 | 455 | 3.0E-26 |
| sp|Q92109|CP1A3_ONCMY | Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 | 33 | 415 | 3.0E-26 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 31 | 421 | 4.0E-26 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 31 | 430 | 4.0E-26 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 10 | 430 | 5.0E-26 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 32 | 418 | 5.0E-26 |
| sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 144 | 419 | 5.0E-26 |
| sp|P05180|CP2H1_CHICK | Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 | 64 | 455 | 6.0E-26 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 32 | 415 | 6.0E-26 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 29 | 433 | 6.0E-26 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 31 | 421 | 6.0E-26 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 31 | 430 | 6.0E-26 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 230 | 454 | 6.0E-26 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 29 | 433 | 8.0E-26 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 31 | 430 | 9.0E-26 |
| sp|Q29488|CP2DH_MACFA | Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 | 170 | 420 | 1.0E-25 |
| sp|Q5KQT7|CP1A1_FELCA | Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 | 32 | 415 | 1.0E-25 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 11 | 454 | 1.0E-25 |
| sp|Q8WNE1|CP2F5_GORGO | Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 | 146 | 431 | 2.0E-25 |
| sp|P12789|CP2B5_RABIT | Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 | 219 | 431 | 2.0E-25 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 146 | 421 | 2.0E-25 |
| sp|P24453|CP1A2_MESAU | Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 | 32 | 450 | 2.0E-25 |
| sp|P48418|C75A1_PETHY | Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 | 25 | 418 | 2.0E-25 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 31 | 421 | 2.0E-25 |
| sp|O18992|CP2DJ_CALJA | Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 | 137 | 419 | 3.0E-25 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 31 | 431 | 3.0E-25 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 223 | 420 | 3.0E-25 |
| sp|Q4H4C3|CP1A2_MACFU | Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 | 144 | 415 | 3.0E-25 |
| sp|O48922|C98A2_SOYBN | Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 | 18 | 444 | 3.0E-25 |
| sp|O77810|CP1A2_CALJA | Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 | 248 | 415 | 4.0E-25 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 226 | 455 | 4.0E-25 |
| sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 31 | 430 | 4.0E-25 |
| sp|Q4WAW8|FTME_ASPFU | Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 | 265 | 471 | 4.0E-25 |
| sp|B9WZX4|FTME_ASPFM | Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 | 265 | 471 | 4.0E-25 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 10 | 430 | 5.0E-25 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 258 | 430 | 5.0E-25 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 10 | 421 | 5.0E-25 |
| sp|P20813|CP2B6_HUMAN | Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 | 223 | 455 | 5.0E-25 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 30 | 438 | 5.0E-25 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 249 | 454 | 6.0E-25 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 32 | 415 | 7.0E-25 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 32 | 421 | 7.0E-25 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 31 | 444 | 1.0E-24 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 10 | 444 | 1.0E-24 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 248 | 445 | 2.0E-24 |
| sp|P00187|CP1A2_RABIT | Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 | 248 | 415 | 2.0E-24 |
| sp|P48419|C75A3_PETHY | Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 | 5 | 418 | 2.0E-24 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 10 | 454 | 2.0E-24 |
| sp|P98181|CP1A1_PAGMA | Cytochrome P450 1A1 OS=Pagrus major GN=cyp1a1 PE=2 SV=1 | 33 | 416 | 2.0E-24 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 32 | 427 | 3.0E-24 |
| sp|P79761|CP1A5_CHICK | Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 | 258 | 415 | 3.0E-24 |
| sp|P10633|CP2D1_RAT | Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 | 12 | 453 | 3.0E-24 |
| sp|Q64391|CP1A2_CAVPO | Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 | 32 | 415 | 3.0E-24 |
| sp|Q16678|CP1B1_HUMAN | Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 | 170 | 457 | 3.0E-24 |
| sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 28 | 438 | 3.0E-24 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 5 | 454 | 4.0E-24 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 32 | 457 | 4.0E-24 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 170 | 457 | 4.0E-24 |
| sp|P33616|CP1A1_MACFA | Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 | 32 | 415 | 4.0E-24 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 10 | 452 | 4.0E-24 |
| sp|Q6GUR1|CP1A1_MACMU | Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 | 32 | 415 | 4.0E-24 |
| sp|P10635|CP2D6_HUMAN | Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 | 144 | 419 | 5.0E-24 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 32 | 427 | 5.0E-24 |
| sp|Q2XNC8|CP2D6_PANTR | Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 | 144 | 419 | 5.0E-24 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 32 | 457 | 5.0E-24 |
| sp|P19100|CP17A_PIG | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 | 35 | 457 | 7.0E-24 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 258 | 455 | 8.0E-24 |
| sp|P00186|CP1A2_MOUSE | Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 | 32 | 449 | 8.0E-24 |
| sp|Q2XNC9|CP2D6_PANPA | Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 | 144 | 420 | 8.0E-24 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 10 | 446 | 1.0E-23 |
| sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 258 | 415 | 1.0E-23 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 144 | 420 | 1.0E-23 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 32 | 415 | 1.0E-23 |
| sp|P12939|CP2DA_RAT | Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 | 12 | 419 | 2.0E-23 |
| sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 149 | 455 | 2.0E-23 |
| sp|P56592|CP1A2_CANLF | Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 | 258 | 415 | 2.0E-23 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 32 | 420 | 2.0E-23 |
| sp|Q54SK0|C508B_DICDI | Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 | 258 | 421 | 3.0E-23 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 247 | 415 | 4.0E-23 |
| sp|P56657|CP240_MOUSE | Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 | 242 | 434 | 4.0E-23 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 207 | 455 | 4.0E-23 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 10 | 454 | 4.0E-23 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 38 | 433 | 4.0E-23 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 5 | 418 | 5.0E-23 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 247 | 454 | 6.0E-23 |
| sp|Q9D816|CP255_MOUSE | Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 | 145 | 430 | 7.0E-23 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 170 | 418 | 8.0E-23 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 219 | 455 | 9.0E-23 |
| sp|Q078T0|PHACB_EMEND | 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 | 34 | 466 | 9.0E-23 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 258 | 421 | 1.0E-22 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 170 | 425 | 1.0E-22 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 144 | 420 | 1.0E-22 |
| sp|P11510|CP2CC_RAT | Cytochrome P450 2C12, female-specific OS=Rattus norvegicus GN=Cyp2c12 PE=2 SV=1 | 215 | 431 | 2.0E-22 |
| sp|Q29478|CP2CV_CAPHE | Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 | 236 | 445 | 2.0E-22 |
| sp|H2DH20|C7D13_PANGI | Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 | 13 | 403 | 2.0E-22 |
| sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 31 | 430 | 2.0E-22 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 249 | 454 | 2.0E-22 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 236 | 454 | 3.0E-22 |
| sp|Q5KQT6|CP1A2_FELCA | Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 | 258 | 415 | 3.0E-22 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 188 | 444 | 3.0E-22 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 32 | 457 | 3.0E-22 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 32 | 457 | 3.0E-22 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 32 | 457 | 3.0E-22 |
| sp|Q9CA61|C98A8_ARATH | Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 | 239 | 444 | 3.0E-22 |
| sp|Q9VG17|CP304_DROME | Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 | 269 | 448 | 5.0E-22 |
| sp|P04799|CP1A2_RAT | Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 | 32 | 415 | 5.0E-22 |
| sp|P05178|CP2C6_RAT | Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 | 145 | 430 | 6.0E-22 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 219 | 430 | 7.0E-22 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 258 | 455 | 7.0E-22 |
| sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 31 | 415 | 8.0E-22 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 13 | 403 | 1.0E-21 |
| sp|P33273|CP255_RAT | Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 | 145 | 430 | 1.0E-21 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 12 | 443 | 1.0E-21 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 144 | 420 | 1.0E-21 |
| sp|Q64562|CP21A_RAT | Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 | 248 | 420 | 2.0E-21 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 2 | 454 | 2.0E-21 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 5 | 429 | 2.0E-21 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 24 | 457 | 2.0E-21 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 17 | 432 | 3.0E-21 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 4 | 427 | 3.0E-21 |
| sp|Q91W64|CP270_MOUSE | Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 | 236 | 454 | 4.0E-21 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 248 | 420 | 4.0E-21 |
| sp|Q54SV9|C515B_DICDI | Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 | 249 | 422 | 4.0E-21 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 172 | 425 | 5.0E-21 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 144 | 420 | 5.0E-21 |
| sp|P00180|CP2C1_RABIT | Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 | 31 | 430 | 5.0E-21 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 236 | 420 | 5.0E-21 |
| sp|H2KYS3|DAF9_CAEEL | Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 | 32 | 418 | 6.0E-21 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 244 | 454 | 7.0E-21 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 8 | 403 | 7.0E-21 |
| sp|Q92090|CP2K1_ONCMY | Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 | 248 | 418 | 7.0E-21 |
| sp|Q9DBX6|CP2S1_MOUSE | Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 | 160 | 454 | 7.0E-21 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 164 | 419 | 8.0E-21 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 10 | 418 | 1.0E-20 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 4 | 418 | 1.0E-20 |
| sp|Q9AR74|TCMO_RUTGR | Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 | 240 | 420 | 1.0E-20 |
| sp|Q6WNQ9|C81E9_MEDTR | Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 | 261 | 455 | 2.0E-20 |
| sp|P11372|CP2CF_RABIT | Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 | 247 | 431 | 2.0E-20 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 262 | 451 | 2.0E-20 |
| sp|Q64403|CP2DG_CAVPO | Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 | 41 | 419 | 2.0E-20 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 246 | 425 | 2.0E-20 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 31 | 430 | 2.0E-20 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 172 | 399 | 2.0E-20 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 151 | 419 | 2.0E-20 |
| sp|Q9SRQ1|C89A9_ARATH | Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 | 12 | 455 | 4.0E-20 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 6 | 455 | 4.0E-20 |
| sp|Q9V399|CP303_DROME | Probable cytochrome P450 303a1 OS=Drosophila melanogaster GN=Cyp303a1 PE=2 SV=1 | 239 | 420 | 4.0E-20 |
| sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 251 | 456 | 4.0E-20 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 223 | 456 | 5.0E-20 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 258 | 418 | 5.0E-20 |
| sp|Q96423|TCMO_GLYEC | Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 | 240 | 448 | 5.0E-20 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 258 | 418 | 5.0E-20 |
| sp|Q43033|TCMO_PETCR | Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 | 240 | 420 | 5.0E-20 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 24 | 457 | 6.0E-20 |
| sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 256 | 425 | 8.0E-20 |
| sp|O64899|C80B1_ESCCA | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 | 18 | 418 | 1.0E-19 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 10 | 446 | 1.0E-19 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 231 | 441 | 1.0E-19 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 219 | 458 | 1.0E-19 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 176 | 458 | 1.0E-19 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 258 | 430 | 1.0E-19 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 258 | 458 | 2.0E-19 |
| sp|O24312|TCMO_POPTM | Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 | 240 | 448 | 2.0E-19 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 258 | 418 | 2.0E-19 |
| sp|Q43054|TCMO_POPKI | Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 | 240 | 448 | 2.0E-19 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 227 | 457 | 2.0E-19 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 213 | 457 | 2.0E-19 |
| sp|Q9FLC8|C79A2_ARATH | Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 | 247 | 419 | 2.0E-19 |
| sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 262 | 436 | 3.0E-19 |
| sp|Q42797|TCMO_SOYBN | Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 | 240 | 448 | 3.0E-19 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 1 | 444 | 3.0E-19 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 20 | 432 | 3.0E-19 |
| sp|O04773|C75A6_CAMME | Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 | 258 | 418 | 4.0E-19 |
| sp|O64900|C80B2_ESCCA | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 | 18 | 418 | 4.0E-19 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 64 | 453 | 4.0E-19 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 221 | 457 | 4.0E-19 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 172 | 399 | 5.0E-19 |
| sp|Q54LA8|C555A_DICDI | Probable cytochrome P450 555A1 OS=Dictyostelium discoideum GN=cyp555A1 PE=3 SV=1 | 249 | 455 | 5.0E-19 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 217 | 440 | 6.0E-19 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 248 | 423 | 6.0E-19 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 248 | 423 | 6.0E-19 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 227 | 421 | 6.0E-19 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 227 | 421 | 6.0E-19 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 29 | 418 | 6.0E-19 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 6 | 421 | 7.0E-19 |
| sp|P37115|TCMO_VIGRR | Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 | 240 | 448 | 8.0E-19 |
| sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 32 | 456 | 8.0E-19 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 227 | 457 | 9.0E-19 |
| sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 258 | 430 | 1.0E-18 |
| sp|Q86A22|C515A_DICDI | Probable cytochrome P450 515A1 OS=Dictyostelium discoideum GN=cyp515A1 PE=3 SV=1 | 246 | 428 | 1.0E-18 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 246 | 420 | 1.0E-18 |
| sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 4 | 405 | 1.0E-18 |
| sp|Q9FXW4|C80B2_COPJA | Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 | 24 | 418 | 1.0E-18 |
| sp|O81971|C71D9_SOYBN | Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 | 7 | 418 | 1.0E-18 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 22 | 428 | 1.0E-18 |
| sp|P48522|TCMO_CATRO | Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 | 240 | 448 | 1.0E-18 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 258 | 454 | 1.0E-18 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 171 | 421 | 1.0E-18 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 226 | 433 | 2.0E-18 |
| sp|P92994|TCMO_ARATH | Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 | 247 | 420 | 2.0E-18 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 213 | 456 | 2.0E-18 |
| sp|Q43240|TCMO_ZINVI | Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 | 247 | 420 | 2.0E-18 |
| sp|O49396|C82C3_ARATH | Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | 246 | 425 | 2.0E-18 |
| sp|Q43067|TCMO_PEA | Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 | 240 | 448 | 2.0E-18 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 235 | 453 | 2.0E-18 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 232 | 457 | 2.0E-18 |
| sp|O65012|C78A4_PINRA | Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 | 246 | 418 | 2.0E-18 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 227 | 421 | 3.0E-18 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 225 | 455 | 3.0E-18 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 158 | 454 | 3.0E-18 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 241 | 418 | 3.0E-18 |
| sp|Q04468|TCMO_HELTU | Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 | 247 | 448 | 3.0E-18 |
| sp|H2DH22|C7A10_PANGI | Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 | 243 | 428 | 4.0E-18 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 221 | 457 | 5.0E-18 |
| sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 32 | 444 | 5.0E-18 |
| sp|Q9SLP1|C78A9_ARATH | Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 | 262 | 451 | 5.0E-18 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 243 | 446 | 6.0E-18 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 30 | 429 | 6.0E-18 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 246 | 420 | 6.0E-18 |
| sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 31 | 418 | 6.0E-18 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 29 | 457 | 6.0E-18 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 227 | 457 | 6.0E-18 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 258 | 446 | 6.0E-18 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 1 | 444 | 6.0E-18 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 24 | 403 | 7.0E-18 |
| sp|Q54WB9|C513D_DICDI | Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 | 258 | 422 | 7.0E-18 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 241 | 419 | 8.0E-18 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 16 | 444 | 8.0E-18 |
| sp|Q54E98|C520B_DICDI | Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 | 261 | 415 | 8.0E-18 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 5 | 418 | 8.0E-18 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 243 | 423 | 9.0E-18 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 31 | 418 | 1.0E-17 |
| sp|O49394|C82C2_ARATH | Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | 246 | 425 | 1.0E-17 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 259 | 454 | 1.0E-17 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 16 | 405 | 1.0E-17 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 16 | 438 | 1.0E-17 |
| sp|I3PFJ5|C76AD_BETVU | Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 | 241 | 403 | 1.0E-17 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 247 | 440 | 1.0E-17 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 249 | 420 | 1.0E-17 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 249 | 420 | 1.0E-17 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 22 | 418 | 1.0E-17 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 244 | 455 | 1.0E-17 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 243 | 421 | 1.0E-17 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 247 | 439 | 1.0E-17 |
| sp|P37114|TCMO_MEDSA | Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1 | 240 | 448 | 1.0E-17 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 213 | 456 | 2.0E-17 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 180 | 442 | 2.0E-17 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 246 | 451 | 2.0E-17 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 221 | 457 | 2.0E-17 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 255 | 420 | 2.0E-17 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 254 | 419 | 2.0E-17 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 258 | 454 | 2.0E-17 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 227 | 421 | 2.0E-17 |
| sp|Q04552|CP6B1_PAPPO | Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 | 5 | 428 | 2.0E-17 |
| sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 1 | 418 | 2.0E-17 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 247 | 440 | 2.0E-17 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 16 | 443 | 3.0E-17 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 247 | 441 | 3.0E-17 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 16 | 432 | 3.0E-17 |
| sp|P37124|C77A2_SOLME | Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 | 258 | 418 | 3.0E-17 |
| sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 247 | 420 | 3.0E-17 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 227 | 421 | 3.0E-17 |
| sp|Q6J540|C79D4_LOTJA | Isoleucine N-monooxygenase 2 OS=Lotus japonicus GN=CYP79D4 PE=1 SV=1 | 263 | 419 | 3.0E-17 |
| sp|Q6J541|C79D3_LOTJA | Isoleucine N-monooxygenase 1 OS=Lotus japonicus GN=CYP79D3 PE=1 SV=1 | 263 | 419 | 3.0E-17 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 243 | 458 | 4.0E-17 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 30 | 457 | 4.0E-17 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 240 | 454 | 5.0E-17 |
| sp|I3V6B1|C80BX_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 | 258 | 400 | 5.0E-17 |
| sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 10 | 447 | 6.0E-17 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 227 | 421 | 6.0E-17 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 248 | 429 | 6.0E-17 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 29 | 418 | 6.0E-17 |
| sp|Q9LMX7|C78A5_ARATH | Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 | 262 | 431 | 6.0E-17 |
| sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 10 | 432 | 6.0E-17 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 258 | 445 | 7.0E-17 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 262 | 435 | 7.0E-17 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 9 | 419 | 7.0E-17 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 243 | 446 | 7.0E-17 |
| sp|P48420|C78A1_MAIZE | Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 | 262 | 418 | 8.0E-17 |
| sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 32 | 418 | 8.0E-17 |
| sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 258 | 433 | 8.0E-17 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 227 | 419 | 9.0E-17 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 240 | 420 | 1.0E-16 |
| sp|A0A087X1C5|CP2D7_HUMAN | Putative cytochrome P450 2D7 OS=Homo sapiens GN=CYP2D7 PE=5 SV=1 | 220 | 426 | 1.0E-16 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 261 | 431 | 1.0E-16 |
| sp|Q9VW43|CP305_DROME | Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 | 216 | 420 | 1.0E-16 |
| sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 243 | 420 | 1.0E-16 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 261 | 431 | 1.0E-16 |
| sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 243 | 420 | 1.0E-16 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 161 | 418 | 2.0E-16 |
| sp|O81928|TCMO_CICAR | Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 | 283 | 448 | 2.0E-16 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 249 | 420 | 2.0E-16 |
| sp|Q1ZXG3|C522A_DICDI | Probable cytochrome P450 522A1 OS=Dictyostelium discoideum GN=cyp522A1 PE=3 SV=1 | 247 | 421 | 2.0E-16 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 221 | 439 | 2.0E-16 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 247 | 440 | 2.0E-16 |
| sp|O93297|CP2K4_ONCMY | Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 | 248 | 418 | 2.0E-16 |
| sp|Q9LZ31|C77A4_ARATH | Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 | 43 | 438 | 2.0E-16 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 199 | 419 | 2.0E-16 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 25 | 419 | 3.0E-16 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 261 | 431 | 3.0E-16 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 227 | 432 | 3.0E-16 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 247 | 441 | 3.0E-16 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 247 | 441 | 3.0E-16 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 249 | 431 | 3.0E-16 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 247 | 420 | 3.0E-16 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 23 | 453 | 3.0E-16 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 29 | 454 | 4.0E-16 |
| sp|Q1ZXI7|C513F_DICDI | Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 | 249 | 415 | 4.0E-16 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 212 | 441 | 4.0E-16 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 251 | 421 | 4.0E-16 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 10 | 403 | 4.0E-16 |
| sp|Q9LTL0|C71BQ_ARATH | Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 | 20 | 403 | 5.0E-16 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 169 | 403 | 5.0E-16 |
| sp|Q9Y7G5|PHACA_EMEND | Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 | 223 | 461 | 5.0E-16 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 261 | 419 | 5.0E-16 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 258 | 421 | 5.0E-16 |
| sp|Q96514|C71B7_ARATH | Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 | 12 | 435 | 6.0E-16 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 247 | 427 | 6.0E-16 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 258 | 446 | 6.0E-16 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 227 | 419 | 6.0E-16 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 32 | 403 | 6.0E-16 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 10 | 403 | 7.0E-16 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 246 | 439 | 8.0E-16 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 227 | 456 | 9.0E-16 |
| sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 246 | 403 | 9.0E-16 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 247 | 420 | 1.0E-15 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 187 | 403 | 1.0E-15 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 246 | 427 | 1.0E-15 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 247 | 439 | 1.0E-15 |
| sp|Q9LW27|C71BF_ARATH | Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 | 10 | 431 | 2.0E-15 |
| sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 262 | 418 | 2.0E-15 |
| sp|Q9M7B8|C79D1_MANES | Valine N-monooxygenase 1 OS=Manihot esculenta GN=CYP79D1 PE=1 SV=1 | 247 | 419 | 2.0E-15 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 23 | 457 | 2.0E-15 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 117 | 420 | 2.0E-15 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 135 | 415 | 2.0E-15 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 221 | 456 | 2.0E-15 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 225 | 457 | 2.0E-15 |
| sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 243 | 454 | 2.0E-15 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 249 | 423 | 2.0E-15 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 241 | 432 | 3.0E-15 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 221 | 457 | 3.0E-15 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 262 | 418 | 3.0E-15 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 30 | 444 | 3.0E-15 |
| sp|O93299|CP2K3_ONCMY | Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1 | 248 | 418 | 3.0E-15 |
| sp|Q54QD0|C5174_DICDI | Probable cytochrome P450 517A4 OS=Dictyostelium discoideum GN=cyp517A4 PE=3 SV=1 | 258 | 427 | 4.0E-15 |
| sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 233 | 418 | 4.0E-15 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 249 | 420 | 4.0E-15 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 247 | 441 | 4.0E-15 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 247 | 441 | 4.0E-15 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 262 | 441 | 5.0E-15 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 243 | 435 | 5.0E-15 |
| sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 233 | 418 | 5.0E-15 |
| sp|Q54QD2|C5171_DICDI | Probable cytochrome P450 517A1 OS=Dictyostelium discoideum GN=cyp517A1 PE=2 SV=1 | 258 | 427 | 5.0E-15 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 216 | 444 | 6.0E-15 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 229 | 419 | 6.0E-15 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 240 | 423 | 7.0E-15 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 228 | 446 | 7.0E-15 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 248 | 403 | 7.0E-15 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 239 | 403 | 7.0E-15 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 242 | 441 | 7.0E-15 |
| sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 262 | 429 | 8.0E-15 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 1 | 400 | 8.0E-15 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 258 | 420 | 9.0E-15 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 258 | 454 | 9.0E-15 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 227 | 419 | 1.0E-14 |
| sp|Q43135|C79A1_SORBI | Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 | 247 | 454 | 1.0E-14 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 227 | 455 | 1.0E-14 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 227 | 455 | 1.0E-14 |
| sp|O81346|C79B2_ARATH | Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 | 247 | 431 | 1.0E-14 |
| sp|Q54NY3|C554A_DICDI | Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 | 249 | 420 | 2.0E-14 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 221 | 421 | 2.0E-14 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 193 | 454 | 2.0E-14 |
| sp|Q54KV0|C513B_DICDI | Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 | 10 | 415 | 2.0E-14 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 262 | 420 | 2.0E-14 |
| sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 195 | 428 | 2.0E-14 |
| sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 258 | 429 | 2.0E-14 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 30 | 421 | 2.0E-14 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 258 | 439 | 2.0E-14 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 5 | 428 | 2.0E-14 |
| sp|Q9M7B7|C79D2_MANES | Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 | 281 | 419 | 2.0E-14 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 5 | 419 | 2.0E-14 |
| sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 13 | 419 | 2.0E-14 |
| sp|Q9SAE3|C71BS_ARATH | Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 | 31 | 400 | 2.0E-14 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 239 | 420 | 2.0E-14 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 23 | 454 | 2.0E-14 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 31 | 432 | 3.0E-14 |
| sp|O81345|C79B1_SINAL | Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 | 247 | 431 | 3.0E-14 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 214 | 403 | 3.0E-14 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 194 | 418 | 3.0E-14 |
| sp|Q54LT7|C519E_DICDI | Probable cytochrome P450 519E1 OS=Dictyostelium discoideum GN=cyp519E1 PE=3 SV=1 | 261 | 456 | 3.0E-14 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 249 | 447 | 3.0E-14 |
| sp|O49859|C82A4_SOYBN | Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 | 246 | 420 | 4.0E-14 |
| sp|O23976|C76B1_HELTU | 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 | 29 | 418 | 4.0E-14 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 247 | 456 | 4.0E-14 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 6 | 149 | 5.0E-08 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 5 | 22 | 17 |
| 2 | 163 | 185 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|30 MGNTFLIQGLFVFLGLLIYYGYHRKTAVRNLPPGPRPLPLVGNINDLPPEGAPEYLHWLKHKDRFGLISSISVFG QTVVILHDRKAAHQLLEKTAKRTSARPIMQFALQLCGFNRFLPAKQFDDSYRWQRRLIHQQLGSKSAVEKNDPLV NLINRMMYNFSQAFTSMTWLVDVIPMIINLPGILPGMGFKKTAKRYDRINQAVSDIPYSFACNQMKTPNPRPSYV ARLLQESKSTDKPRTQKEMSDTEEAIKYSAAILFGGGADTTSSNLSSFLLAMTLFPDVQRRAQQEIDSVTGSSNR LPRFEDRHKMPYMEGVIKESLRWLPVTPLGTAHRLTEDTIYGDYFLPKETHIIPAIWWFTHDPEVYQDPDRFDPE RYLSRNEPDPRSVVFGFGRRRCPGLHFADSNLFSIITQLLAVFSIRKAVDEKGVEIEGKLKATPGLIAHPVTFPY RIIPRDADKVRLLEKMEASHPWEKSDATFVAEEIASWRLEEH* |
| Coding | >Hirsu2|30 ATGGGAAATACCTTTTTGATACAGGGCCTTTTCGTTTTTCTTGGCCTTCTCATTTATTATGGATATCACCGGAAA ACAGCAGTACGAAACCTTCCCCCCGGACCGAGACCCTTGCCGCTCGTCGGCAACATCAACGACCTCCCACCGGAA GGGGCGCCGGAATACCTGCACTGGTTGAAGCACAAAGATCGCTTCGGCCTCATTAGCTCGATCAGTGTTTTCGGC CAGACTGTTGTTATTCTTCACGATAGAAAAGCCGCACACCAACTGCTGGAGAAAACGGCCAAGAGGACATCGGCG CGGCCTATCATGCAGTTCGCCCTTCAACTCTGCGGCTTTAATCGCTTCCTTCCGGCCAAGCAGTTCGATGACAGC TATCGATGGCAGCGCAGACTGATTCATCAGCAGCTGGGCTCGAAATCTGCGGTGGAAAAGAACGACCCCCTGGTC AACTTGATCAACCGTATGATGTACAATTTCTCGCAAGCGTTCACATCGATGACCTGGCTGGTCGATGTTATTCCC ATGATAATAAATCTGCCCGGTATCTTACCCGGAATGGGCTTCAAGAAGACTGCAAAGCGATACGATCGAATCAAC CAAGCAGTATCGGACATCCCTTATTCGTTTGCGTGCAACCAGATGAAGACTCCCAATCCCCGACCATCCTACGTT GCTAGGCTACTGCAGGAAAGCAAGAGCACCGATAAGCCCCGAACGCAGAAAGAGATGAGCGATACCGAGGAGGCA ATCAAGTATTCTGCCGCCATCCTCTTCGGTGGAGGTGCGGATACTACCTCGTCTAATTTAAGCAGCTTCCTTTTG GCCATGACTTTATTCCCAGACGTACAGCGAAGAGCTCAACAGGAGATTGATAGCGTTACCGGGTCGTCGAATAGG CTTCCTCGCTTTGAGGATCGGCATAAGATGCCATACATGGAGGGGGTTATAAAGGAATCCCTTCGTTGGCTTCCT GTCACACCCCTGGGGACGGCCCACAGGTTGACTGAAGATACCATTTATGGCGACTACTTCCTTCCCAAGGAGACG CATATCATACCCGCGATATGGTGGTTCACGCATGACCCTGAGGTATACCAGGATCCAGACAGATTTGACCCTGAG CGCTACCTGTCACGCAACGAGCCCGATCCGCGATCCGTGGTATTTGGCTTCGGCCGCAGGAGATGCCCAGGTCTG CATTTTGCCGATTCCAACCTCTTTTCAATTATCACACAGCTCCTAGCCGTCTTTAGTATCAGGAAGGCTGTCGAC GAAAAAGGGGTCGAGATTGAAGGGAAACTGAAAGCCACGCCGGGTCTGATCGCTCACCCGGTTACATTTCCGTAC AGAATCATACCAAGAGACGCAGATAAGGTGAGACTGCTAGAGAAGATGGAGGCGAGCCACCCGTGGGAGAAAAGC GATGCGACTTTTGTGGCAGAGGAAATCGCGTCTTGGCGCCTAGAGGAACATTGA |
| Transcript | >Hirsu2|30 ATGGGAAATACCTTTTTGATACAGGGCCTTTTCGTTTTTCTTGGCCTTCTCATTTATTATGGATATCACCGGAAA ACAGCAGTACGAAACCTTCCCCCCGGACCGAGACCCTTGCCGCTCGTCGGCAACATCAACGACCTCCCACCGGAA GGGGCGCCGGAATACCTGCACTGGTTGAAGCACAAAGATCGCTTCGGCCTCATTAGCTCGATCAGTGTTTTCGGC CAGACTGTTGTTATTCTTCACGATAGAAAAGCCGCACACCAACTGCTGGAGAAAACGGCCAAGAGGACATCGGCG CGGCCTATCATGCAGTTCGCCCTTCAACTCTGCGGCTTTAATCGCTTCCTTCCGGCCAAGCAGTTCGATGACAGC TATCGATGGCAGCGCAGACTGATTCATCAGCAGCTGGGCTCGAAATCTGCGGTGGAAAAGAACGACCCCCTGGTC AACTTGATCAACCGTATGATGTACAATTTCTCGCAAGCGTTCACATCGATGACCTGGCTGGTCGATGTTATTCCC ATGATAATAAATCTGCCCGGTATCTTACCCGGAATGGGCTTCAAGAAGACTGCAAAGCGATACGATCGAATCAAC CAAGCAGTATCGGACATCCCTTATTCGTTTGCGTGCAACCAGATGAAGACTCCCAATCCCCGACCATCCTACGTT GCTAGGCTACTGCAGGAAAGCAAGAGCACCGATAAGCCCCGAACGCAGAAAGAGATGAGCGATACCGAGGAGGCA ATCAAGTATTCTGCCGCCATCCTCTTCGGTGGAGGTGCGGATACTACCTCGTCTAATTTAAGCAGCTTCCTTTTG GCCATGACTTTATTCCCAGACGTACAGCGAAGAGCTCAACAGGAGATTGATAGCGTTACCGGGTCGTCGAATAGG CTTCCTCGCTTTGAGGATCGGCATAAGATGCCATACATGGAGGGGGTTATAAAGGAATCCCTTCGTTGGCTTCCT GTCACACCCCTGGGGACGGCCCACAGGTTGACTGAAGATACCATTTATGGCGACTACTTCCTTCCCAAGGAGACG CATATCATACCCGCGATATGGTGGTTCACGCATGACCCTGAGGTATACCAGGATCCAGACAGATTTGACCCTGAG CGCTACCTGTCACGCAACGAGCCCGATCCGCGATCCGTGGTATTTGGCTTCGGCCGCAGGAGATGCCCAGGTCTG CATTTTGCCGATTCCAACCTCTTTTCAATTATCACACAGCTCCTAGCCGTCTTTAGTATCAGGAAGGCTGTCGAC GAAAAAGGGGTCGAGATTGAAGGGAAACTGAAAGCCACGCCGGGTCTGATCGCTCACCCGGTTACATTTCCGTAC AGAATCATACCAAGAGACGCAGATAAGGTGAGACTGCTAGAGAAGATGGAGGCGAGCCACCCGTGGGAGAAAAGC GATGCGACTTTTGTGGCAGAGGAAATCGCGTCTTGGCGCCTAGAGGAACATTGA |
| Gene | >Hirsu2|30 ATGGGAAATACCTTTTTGATACAGGGCCTTTTCGTTTTTCTTGGCCTTCTCATTTATTATGGATATCACCGGAAA ACAGCAGTACGAAACCTTCCCCCCGGACCGAGACCCTTGCCGCTCGTCGGCAACATCAACGACCTCCCACCGGAA GGGGCGCCGGAATACCTGCACTGGTTGAAGCACAAAGATCGCTTCGGCCTCATTAGCTCGATCAGTGTTTTCGGC CAGACTGTTGTTATTCTTCACGATAGAAAAGCCGCACACCAACTGCTGGAGAAAACGGCCAAGAGGACATCGGCG CGGCCTATCATGCAGTTCGCCCTTCAACTCTGCGGCTTTAATCGCTTCCTTCCGGCCAAGCAGTTCGATGACAGC TATCGATGGCAGCGCAGACTGATTCATCAGCAGCTGGGCTCGAAATCTGCGGTGGTACGCTTTCACGGAGTCGTG GAAGAGGAAACGAAGACGTTTCTGCTGCGAGTTTGGCGAGAACCGGAAAACTTGATTCAGCTTTTAAAGAAGTAG GTCCCTTGCCCCTAAGGTCTCTTATCAGAGCACTGGCAGATGGACCATGACTCGCGTTGCTGTGCATGGCCGGCG GCAGTCCGTCCAGCTGACTCTATGTCAGTATTACAGGGGCCATCATACTGAAAACGACATACGGCTACGCTATAG ACCAGGAAAAGAACGACCCCCTGGTCAACTTGATCAACCGTATGATGTACAATTTCTCGCAAGCGTTCACATCGA TGACCTGGCTGGTCGATGTTATTCCCATGATAATAAATCTGCCCGGTATCTTACCCGGAATGGGCTTCAAGAAGA CTGCAAAGCGATACGATCGAATCAACCAAGCAGTATCGGACATCCCTTATTCGTTTGCGTGCAACCAGATGAAGA CTCCCAATCCCCGACCATCCTACGTTGCTAGGCTACTGCAGGAAAGCAAGAGCACCGATAAGCCCCGAACGCAGA AAGAGATGAGCGATACCGAGGAGGCAATCAAGTATTCTGCCGCCATCCTCTTCGGTGGAGGTGCGGATACTACCT CGTCTAATTTAAGCAGCTTCCTTTTGGCCATGACTTTATTCCCAGACGTACAGCGAAGAGCTCAACAGGAGATTG ATAGCGTTACCGGGTCGTCGAATAGGCTTCCTCGCTTTGAGGATCGGCATAAGATGCCATACATGGAGGGGGTTA TAAAGGAATCCCTTCGTTGGCTTCCTGTCACACCCCTGGGGACGGCCCACAGGTTGACTGAAGATACCATTTATG GCGACTACTTCCTTCCCAAGGAGACGCATATCATACCCGCGATATGGTGGTTCACGCATGACCCTGAGGTATACC AGGATCCAGACAGATTTGACCCTGAGCGCTACCTGTCACGCAACGAGCCCGATCCGCGATCCGTGGTATTTGGCT TCGGCCGCAGGAGATGCCCAGGTCTGCATTTTGCCGATTCCAACCTCTTTTCAATTATCACACAGCTCCTAGCCG TCTTTAGTATCAGGAAGGCTGTCGACGAAAAAGGGGTCGAGATTGAAGGGAAACTGAAAGCCACGCCGGGTCTGA TCGCTCACCCGGTTACATTTCCGTACAGAATCATACCAAGAGACGCAGATAAGGTGAGACTGCTAGAGAAGATGG AGGCGAGCCACCCGTGGGAGAAAAGCGATGCGACTTTTGTGGCAGAGGAAATCGCGTCTTGGCGCCTAGAGGAAC ATTGA |